KEGG   Streptococcus pneumoniae ST556 (serotype 19F): MYY_0473Help
Entry
MYY_0473          CDS       T02087                                 

Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
snd  Streptococcus pneumoniae ST556 (serotype 19F)
Pathway
snd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:snd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    MYY_0473
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:snd03400]
    MYY_0473
Enzymes [BR:snd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MYY_0473
DNA repair and recombination proteins [BR:snd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MYY_0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 SH3_13 Viral_helicase1 AAA_11 UvrD_C UvrD-helicase DEAD AAA_22 RsgA_GTPase HHH_5 Herpes_Helicase T2SSE AAA_12 5_3_exonuc NTPase_1 DNA_pol_lambd_f AAA_28 AAA_29 MeaB DUF2075 AAA
Motif
Other DBs
NCBI-ProteinID: AFC94134
Position
complement(444120..446486)
Genome map
AA seq 788 aa AA seqDB search
MEVYFSGTIERIIFENPSNFYRILLLEIDDTDAEDFDDFEIIVTGTMADVIEGEDYTFWG
QIVQHSKYGEQLQISRYDRAKPTSKGLVKYFSSSHFKGIGLKTAQKIVDTYGENTIDEIL
QHPEKLEGIVGLSAKNREAFVSTLRLNYGTEMILAKLANYGIPNKLAFQIQDFYKEETLD
VVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPERFRAGLVHSLFQACMETGDTYVEV
RDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDKVQQIDTKIFDNSLFFAEEGIRSHL
VRILEKGKQKSHDLETIQKHITTIEEELGIEYDNIQKQAICDAIQNKVFILTGGPGTGKT
TVINGIIAVYALLEGLDLRKKSNLPILLAAPTGRAARRMNELTGLPSATIHRHLGMTGDD
DTSHLEDYLDTDFIIVDEFSMVDTWLANQLFSNISSNSKILIVGDSDQLPSVSPGQVLAD
LLHIPLIPQTRLEKIYRQSEESTIVTLASQIRQGILPADFTQKKADRSYFEIASGHIPAT
IEKILGAALRNGIPARDIQVLAPMYRGTAGIDAINQLMQDLLNPPQKDQLSFEAPQCHYR
KGDKVIHLVNDTEINVFNGDLGAITDLIPGKYTESKQDEIVIDFDGNEVSYPRNEWYKIR
LAYAMSIHKSQGSEFPVVILPITSASRRMLERNLIYTAITRAKSKLILLGELQAFDHATQ
HIGTARKTYLVERFSDLLKNVEEKQQAVSETVTSSASEQSYILTEENWDRIPAMIGITDT
DLKEIFGK
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggaagtttatttttcaggaactattgaacggattatttttgaaaatcccagcaatttt
tatcgcatcctcctcctagaaatcgacgatacggacgcagaggattttgatgattttgaa
atcattgtcacaggaaccatggctgatgtaattgagggcgaagactatactttttggggg
caaattgtccagcactccaagtatggagaacaactgcaaatcagtcgttatgatcgcgca
aaaccaactagtaagggcttggtcaagtacttttcaagtagccatttcaaggggattggt
ctcaagacagctcagaaaatcgtggatacctatggcgaaaataccattgacgaaattttg
caacacccagaaaagttagaaggcatcgtaggactctctgccaaaaatcgcgaggctttc
gtctccactctccgtctcaactacggaacggagatgattttggccaaactagccaactac
ggcattcccaacaaactagcctttcagattcaagacttttacaaggaagaaacccttgat
gtggttgaaaattatccctaccagctggttgaggatatcaagggtttgggctttaccatt
gctgaccaactagctgaggaactaggcatcgaaagtcaggctcctgaacgcttccgcgcc
ggtctagttcacagtctttttcaggcctgtatggaaacaggggacacctatgttgaagta
cgggatttgctggaacaaacccttactctccttgagtcttcccgtcccgtggaactagac
cccagccaagttgcccaagagctctcctacctgatcgaagaagacaaggttcagcagatt
gataccaagatctttgacaacagcctctttttcgctgaggaaggcatccgcagtcacttg
gttcgtatccttgaaaaaggaaaacagaagagtcatgatttagaaaccattcaaaaacat
atcactactatcgaggaagagctgggaattgagtatgataacattcaaaaacaggctatc
tgtgatgctatccagaataaggtctttatcctgacaggtggacctggtactggtaagaca
actgttatcaatgggatcatcgctgtttacgccctgttagagggacttgacctcaggaag
aaaagcaacctgcccattcttcttgctgctccaactggacgagccgctcgtcgcatgaat
gaattgacaggcttgcctagcgcgaccatacaccgccacttgggaatgacaggtgacgat
gataccagtcatctggaagattacctagatactgactttatcatcgtggatgaattctct
atggtggatacttggctggccaatcaactcttctccaatatctcttctaacagtaagatc
ctcatcgtaggtgacagtgatcagctaccttctgtcagtcctggacaggttctagcggat
ctgcttcatattcctttgattcctcagactcgcttggaaaaaatttatcgacaaagcgaa
gaatcaaccatcgtcaccctagctagtcagattcgacagggcatcttgccagctgatttc
acccaaaaaaaagctgaccgttcctactttgaaattgctagtggccatattcctgccacc
attgaaaaaatcttaggtgccgccctcagaaatggtattcctgcccgtgatatccaagtt
ctggctcctatgtaccgagggacggcagggattgatgctatcaatcagctcatgcaagac
ctgctcaatcccccacaaaaagatcaactcagttttgaagctcctcagtgccactatcgt
aagggagacaaggtcattcatttggttaacgatactgaaatcaatgtctttaatggggat
ttaggagctatcacagacctgattcctggtaaatacaccgaatcgaaacaagacgagatt
gtcattgattttgatggtaatgaagtctcttacccccgtaacgaatggtacaagattcgc
ttggcctatgccatgagtattcataagtctcagggaagtgagttcccagttgtcatccta
ccgattactagtgctagccgacgtatgctggagcgaaatctcatctacacagccattaca
cgtgccaaaagcaaactcatcttactaggcgaattacaagccttcgaccatgctacccaa
cacatcggaactgcccgaaaaacctatctggttgaacgcttcagtgatctactgaagaat
gttgaagaaaagcaacaagctgtctctgaaacagtcacatcaagtgcctctgaacaatcc
tacatcctaaccgaagaaaactgggaccgcatcccagccatgattgggattacagacaca
gacctcaaagagatttttggaaaatag

DBGET integrated database retrieval system