KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F02040Help
Entry
SPN23F02040       CDS       T00843                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
sne03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sne00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SPN23F02040 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sne03011]
    SPN23F02040 (rplV)
Ribosome [BR:sne03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SPN23F02040 (rplV)
  Bacteria
    SPN23F02040 (rplV)
  Archaea
    SPN23F02040 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CAR68064
UniProt: B8ZKG2
Position
194302..194646
Genome map
AA seq 114 aa AA seqDB search
MAEITSAKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPNKAAEIILKVLNSAVA
NAENNFGLDKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRTAHITVAVAEK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattacttcagctaaagcaatggctcgtacagtacgtgtttcacctcgtaaa
tcacgtcttgttcttgataacatccgtggtaaaagcgtagccgatgcaatcgcaatcttg
acattcactccaaacaaagctgctgaaatcatcttgaaagttttgaactcagctgtagct
aacgctgaaaacaactttggtttggataaagctaacttggtagtatctgaagcattcgca
aacgaaggaccaactatgaaacgtttccgtccacgtgcgaaaggttcagcttcaccaatc
aacaaacgtacagctcacatcactgtagctgttgcagaaaaataa

DBGET integrated database retrieval system