KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F02880Help
Entry
SPN23F02880       CDS       T00843                                 

Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
sne00480  Glutathione metabolism
sne00590  Arachidonic acid metabolism
sne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sne00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SPN23F02880
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SPN23F02880
Enzymes [BR:sne01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SPN23F02880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4174 Lipoprotein_15
Motif
Other DBs
NCBI-ProteinID: CAR68146
Position
complement(274033..274509)
Genome map
AA seq 158 aa AA seqDB search
MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTATGCGLTPQYQGLQELYERYQDQGFEIL
DFPCNQFMGQAPGSAEEINAFCSLHFQTTFPRFAKIKVNGKEADPLYVWLKDQKSGPLGK
RVEWNFAKFLIGRDGQVFERFSSKTDPKQIEEAIQTLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacttcactttatgatttttccgttttgaaccaaaacaaccaagcaactcccttggat
agctatcgtggcaaagttctcttgattgtcaacactgctactggatgtggtttaacgccc
cagtaccagggacttcaagaactctatgaacgctatcaagatcagggcttcgaaatattg
gatttcccttgcaatcagtttatgggacaagcacccggcagcgcagaggaaatcaacgcc
ttctgtagcctacattttcaaaccaccttcccacgttttgccaagattaaggtcaacggt
aaggaagcagaccctctctatgtctggttaaaagaccagaaatccggcccactaggaaaa
cgagtcgaatggaatttcgctaagtttctcatcggtcgagatgggcaagtctttgaacgc
ttttcttcaaaaacagacccaaaacaaattgaagaggcgatacaaactctactataa

DBGET integrated database retrieval system