KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F04090Help
Entry
SPN23F04090       CDS       T00843                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
sne00970  Aminoacyl-tRNA biosynthesis
sne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sne00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPN23F04090 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sne03029]
    SPN23F04090 (gatB)
Enzymes [BR:sne01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SPN23F04090 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SPN23F04090 (gatB)
Mitochondrial biogenesis [BR:sne03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SPN23F04090 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: CAR68258
UniProt: B8ZLK0
Position
complement(391340..392782)
Genome map
AA seq 480 aa AA seqDB search
MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGI
KAALALNMDIHKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIE
RAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEVIQYAG
ISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFSNVRKGLEYEVQRQAEILRSG
GQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDLPLFEISDEWIEEMRTELPEFPKE
RRARYVSDLGLSDYDASQLTANKVTSNFFEKAVALGGDAKQVSNWLQGEVAQFLNAEGKT
LEQIELTPENLVEMITIIEDGTISSKIAKKVFVHLAKNGGGAREYVEKAGMVQISDPAIL
IPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMRATKGQANPQVALKLLAQELAKLKEN
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaacagtcatcggacttgaagtccacgtagagctcaacaccaattcaaaa
atcttctcacctacttctgcccactttggaaatgaccaaaatgccaacactaacgtgatt
gactggtctttcccaggagttctaccagttctcaataaaggggttgttgatgccggtatc
aaggctgctcttgccctcaacatggacatccacaaaaagatgcactttgaccgcaagaac
tacttctatcctgataaccccaaagcctaccaaatttctcagtttgatgagccaatcggt
tataacggctggattgaagtcgagctagaagacggtacgaccaagaaaatcggtatcgaa
cgtgcccacctagaggaagacgctggtaaaaacacccatggtacagatggctactcttat
gttgacctcaaccgccaaggggttcccttgattgagattgtatctgaggcagatatgcgt
tctcctgaagaagcctatgcttatctgacagccctcaaggaagttatccagtacgctggc
atttctgacgttaagatggaggaaggttcgatgcgtgtggatgccaacatctcccttcgt
ccttatggtcaagagaaattcggtaccaagactgaattgaagaacctcaactccttctca
aacgttcgcaaggggcttgaatacgaagtccaacgtcaagctgaaatacttcgctcaggt
ggtcaaatccgccaagaaacacgccgttacgatgaagctaacaaagcaaccatcctcatg
cgtgtcaaggaaggggctgctgactaccgctacttcccagaaccagacctacccctcttt
gaaatttctgacgagtggattgaggaaatgcggactgagttgccagagtttccaaaagaa
cgtcgtgcgcgttatgtatctgaccttggtttatcagactacgatgctagtcagttgact
gctaataaagtcacttctaacttctttgaaaaagctgttgccctaggtggtgatgccaaa
caagtctctaactggctccaaggggaagtcgctcagttcttgaatgctgaaggtaaaaca
ctggaacaaatcgaattgacaccagaaaacttggttgaaatgattaccatcatcgaagac
ggtactatttcatctaagattgccaagaaagtctttgtccatctagctaaaaatggcggt
ggcgcgcgtgaatacgtggaaaaagcaggtatggttcaaatttcagatccagctatcttg
atcccaatcatccaccaagtctttgccgataacgaagctgctgttgccgacttcaagtca
ggcaaacgtaatgcagacaaggccttcacaggattccttatgagggcaaccaaaggccaa
gccaacccacaagttgcccttaaactacttgcacaggaattggcgaagttgaaagaaaac
tag

DBGET integrated database retrieval system