KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F11340Help
Entry
SPN23F11340       CDS       T00843                                 

Gene name
uvrB
Definition
(GenBank) UvrABC system protein B (UvrB protein)
  KO
K03702  excinuclease ABC subunit B
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
sne03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sne00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPN23F11340 (uvrB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sne03400]
    SPN23F11340 (uvrB)
DNA repair and recombination proteins [BR:sne03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SPN23F11340 (uvrB)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      SPN23F11340 (uvrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrB Helicase_C ResIII UVR DEAD AAA_30 Kinesin Microtub_bd DUF2299 AAA_16 AAA AAA_5 AAA_25 AAA_22 HTH_22
Motif
Other DBs
NCBI-ProteinID: CAR68943
UniProt: B8ZJQ9
Position
complement(1105278..1107266)
Genome map
AA seq 662 aa AA seqDB search
MINHITDNQFKLVSKYQPSGDQPQAIEQLVDNIEGGEKAQILMGATGTGKTYTMSQVISK
VNKPTLVIAHNKTLAGQLYGEFKEFFPENAVEYFVSYYDYYQPEAYVPSSDTYIEKDSSV
NDEIDKLRHSATSALLERNDVIVVASVSCIYGLGSPKEYADSVVSLRPGLEISRDKLLND
LVDIQFERNDIDFQRGRFRVRGDVVEIFPASRDEHAFRVEFFGDEIDRIREVEALTGQVL
GEVDHLAIFPATHFVTNDDHMEVAIAKIQAELEEQLAVFEKEGKLLEAQRLKQRTEYDIE
MLREMGYTNGVENYSRHMDGRSEGEPPYTLLDFFPDDFLIMIDESHMTIGQIKGMYNGDR
SRKEMLVNYGFRLPSALDNRPLRREEFESHVHQIVYVSATPGDYENEQTETVIEQIIRPT
GLLDPEVEVRPTMGQIDDLLGEINARVEKNERTFITTLTKKMAEDLTDYFKEMGIKVKYM
HSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDVPEVSLVAILDADKEGFLRNERGLI
QTIGRAARNSEGHVIMYADTVTQSMQRAIDETARRRKIQMAYNEEHGIVPQTIKKEIRDL
IAVTKAVAKEEDKEVDINSLNKQERKELVKKLEKQMQEAVEVLDFELAAQIRDMMLEVKA
LD
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatcacattacagataatcaatttaaactagtatcaaaatatcaaccatcagga
gatcaaccccaagctatcgagcagttggtggataacattgaggggggagaaaaagctcag
attctgatgggggcgactggaacagggaagacctatactatgagtcaggtcatttctaaa
gtcaataaaccaactctggttattgcccacaataaaactctggctggtcagctctatggg
gagtttaaggaatttttccctgaaaatgcagttgagtatttcgtatcctactatgattat
taccagccagaggcctatgtcccttctagcgatacctatattgagaaggatagttctgtc
aatgacgagattgacaagcttcgccactcagctacctcagcccttttggagcgtaatgat
gttattgtcgtggcctcagtctcttgtatctatggtttgggttcgcccaaggaatacgct
gatagtgtcgttagtctccgtcctggtctagagatttctcgtgataaactcttgaatgac
ttggtcgatattcagtttgaacgtaatgatattgatttccaacgcggaagatttcgcgtt
cgtggggatgtggtagagattttcccagcttcccgagatgaacatgcctttcgagtagaa
ttttttggagacgaaattgaccgtattcgtgaagttgaggctctgacaggtcaggtgttg
ggagaagtggatcatttagcgattttcccagcgacacactttgtgaccaatgacgaccac
atggaagttgccattgcaaagattcaggccgagttggaagaacaattagctgtctttgaa
aaggaaggtaaactgcttgaagcccagcgtttgaaacagcggacagagtatgatatcgaa
atgttgcgtgagatgggctataccaatggggttgaaaattattctcgccacatggatgga
cggagcgaaggagagcctccttatacgcttctcgacttcttcccagatgatttcttgatt
atgattgacgagagtcatatgaccatagggcaaatcaagggcatgtacaatggagaccgt
tcgcgtaaagaaatgctggttaattatggtttccgtttgccgtctgctttggacaatcgt
cctctccgtcgggaggagtttgagagtcacgttcatcagattgtttacgtttcagcgaca
cctggtgactatgaaaatgaacagaccgagacagtgattgagcaaatcattcgtccaacg
ggactcttggatccagaggtggaagtccgtccgactatgggacagattgatgacctcttg
ggtgaaatcaatgcccgcgttgaaaaaaatgagcgtacctttatcacaactttgaccaag
aaaatggcagaggatttgaccgactacttcaaggaaatgggtatcaaggtcaagtacatg
cactcggatatcaagaccttggaacggacggagattatccgtgacctgcgcttgggtgtc
tttgatgtcttggtcggaattaacctgctccgtgaaggaattgacgttcctgaagtgagc
ctcgtagctattctcgatgctgacaaggaaggtttccttcgcaacgaacgtggactcatc
cagactattggacgtgctgctcgtaacagtgaaggccatgtcatcatgtatgcagacacg
gttacccagtctatgcaacgtgctatcgatgaaactgcccgccgtcggaaaattcagatg
gcctataatgaagagcatggtatcgtaccacagacaatcaagaaagaaatccgtgacctg
attgccgtgaccaaggcagttgctaaggaagaggacaaggaagtcgacatcaatagcctc
aacaaacaagagcgcaaagaactcgtcaagaaactagaaaaacaaatgcaagaagccgtc
gaagtgcttgactttgaactggcggctcagatccgtgatatgatgttggaagtcaaggcc
ttggattag

DBGET integrated database retrieval system