KEGG   Simkania negevensis: SNE_A07830Help
Entry
SNE_A07830        CDS       T01559                                 

Gene name
gdh
Definition
(GenBank) glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
sng  Simkania negevensis
Pathway
sng00030  Pentose phosphate pathway
sng01100  Metabolic pathways
sng01120  Microbial metabolism in diverse environments
sng01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SNE_A07830 (gdh)
Enzymes [BR:sng01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     SNE_A07830 (gdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR THF_DHG_CYH_C Epimerase PALP ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: CCB88660
UniProt: F8L7D3
Position
gsn.131:816408..817265
Genome map
AA seq 285 aa AA seqDB search
MEKYPKQKPAEVVMPVCDLPDLLKGQKAIVTGSSSGIGKGVAIALAKAGADVVINYAGSK
ERAEEVAQEVSAIGRQALVIKADVSQEDQVQAMFKETVEKFGTVDIVINNAGLQKDSCFA
DMTIDQWNKVIGINLTGQFLCSREAIREFLRRGIRKEVSCAAGKIICMSSVHEMIPWSGH
ANYAASKGGVMLLMKSIAQEYASQRIRVNSICPGAIRTPINKEAWETPEAYEKLMNVIPY
KRIGEPPDIGHTAVWLASDLADYINGTSIFVDGGMTLFPGFTTNG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatcccaaacaaaaacccgcagaggttgtgatgccagtgtgcgacttaccc
gatttgctgaaaggacaaaaagcaatcgtgaccggatcaagttcaggaattggaaaaggg
gtggcaattgcattagcaaaagctggagcggatgttgtcatcaattatgcaggttcgaaa
gaacgggcagaagaagtggctcaagaagtctcagcgataggtcgtcaggcattggtcatt
aaagcggatgtatctcaggaagatcaagtccaagcgatgttcaaggaaaccgttgagaag
tttggcacagtggatatcgtgatcaacaatgcaggcctccaaaaagattcctgcttcgca
gatatgacaatcgatcagtggaataaagtgatcgggatcaaccttacagggcagttttta
tgttcacgtgaagcgattcgagagtttttacgacgaggtatacgtaaagaagtttcttgc
gctgctggcaaaatcatttgcatgagctcagttcatgaaatgattccttggtcaggtcac
gctaattatgctgcctctaaagggggcgtgatgctcttgatgaagagtattgctcaagaa
tatgcctctcagagaatccgtgtgaacagcatctgtcctggggcaattcgaacacctatc
aataaagaagcttgggagactcctgaagcttatgaaaaactcatgaacgtgattccctat
aaacgtattggtgaaccaccagacattggacacactgctgtttggcttgcttcggactta
gctgactatatcaatggaacaagcatctttgtcgatggtggaatgaccttattcccagga
tttactaccaacggatag

DBGET integrated database retrieval system