KEGG   Simkania negevensis: SNE_A10220Help
Entry
SNE_A10220        CDS       T01559                                 

Gene name
tRPA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sng  Simkania negevensis
Pathway
sng00260  Glycine, serine and threonine metabolism
sng00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sng01100  Metabolic pathways
sng01110  Biosynthesis of secondary metabolites
sng01130  Biosynthesis of antibiotics
sng01230  Biosynthesis of amino acids
Module
sng_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SNE_A10220 (tRPA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SNE_A10220 (tRPA)
Enzymes [BR:sng01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SNE_A10220 (tRPA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB BtpA His_biosynth ParA PA
Motif
Other DBs
NCBI-ProteinID: CCB88899
UniProt: F8L7Z7
Position
gsn.131:1054069..1054830
Genome map
AA seq 253 aa AA seqDB search
MIRELFEKKKAYIGYLTAGDGGLEHTEKMALALVEGGVDLLELGIPFSEPIADGPVIQDA
VERALDAGTTPHQVIELVSRLRKKIAVPIVLMTYFNPIFVAGQEFLKEAKAAGVNGLLIV
DLPPEEADDYLTWMKEAELETIFIVAPSTPEERIPTICRISTGFIYYACRKGTTGMKKGV
PEDLPEKIAQIRRHTDLPIAVGFGVSSAEIAREILTYADGFIVGSFLVQAAHEQTNPIEL
TRLAASLDPRSLL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtgaactctttgaaaagaaaaaagcttatattggttacctcacagctggggat
gggggacttgagcatacagaaaaaatggcccttgccctcgttgaagggggcgtcgacctt
ttagaattgggcattcctttttcagaacccattgccgacggtcccgtcattcaagacgct
gttgagcgggccctcgatgctgggaccacacctcaccaggtgatcgaacttgtttctcgt
ttgcgtaagaaaatagctgttccgattgttttaatgacttatttcaaccccatctttgtt
gcaggtcaggaatttttaaaagaggccaaagcagcaggagtgaatgggttgctcattgta
gaccttcctccagaagaagctgatgactatttgacatggatgaaagaggcggagcttgaa
accatctttatcgtggcaccttcaacacccgaagagagaattcctacgatttgcagaatt
tcaacaggctttatttattatgcttgccgaaagggcaccaccggaatgaaaaaaggtgtg
ccagaagatttacccgagaaaattgcccaaatccggcgtcatactgacctgcccatagct
gttggttttggcgtttcttcagcagaaatcgcaagagaaattctcacttatgccgatgga
tttattgtgggttcctttcttgttcaagcggcccatgagcaaaccaatcccatagaattg
acgaggctagcagcctcacttgatcccaggagcttactatga

DBGET integrated database retrieval system