KEGG   Streptococcus pneumoniae INV104 (serotype 1): INV104_09960Help
Entry
INV104_09960      CDS       T02072                                 

Gene name
zmpA
Definition
(GenBank) IgA-protease
  KO
K01390  IgA-specific metalloendopeptidase [EC:3.4.24.13]
Organism
sni  Streptococcus pneumoniae INV104 (serotype 1)
Brite
KEGG Orthology (KO) [BR:sni00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sni01002]
    INV104_09960 (zmpA)
Enzymes [BR:sni01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.13  IgA-specific metalloendopeptidase
     INV104_09960 (zmpA)
Peptidases [BR:sni01002]
 Metallo Peptidases
  Family M26
   INV104_09960 (zmpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M26_C Peptidase_M26_N G5 Glug YSIRK_signal Gram_pos_anchor
Motif
Other DBs
NCBI-ProteinID: CBW36677
Position
1089856..1095747
Genome map
AA seq 1963 aa AA seqDB search
MEKYFGEKQERFSFRKLSVGLVSATISSLFFMSVLASSSVDAQETAGVHYKYVADSELSS
EEKKQLVYDIPTYVENDDETYYLVYKLNSQNQLAELPNTGSKNERQALVAGASLAALGIL
IFAVSKKKVKNKTVLHLVLVAGMGNGVLVSVHALENHLLLNYNTDYELTSGEKLPLPKEI
SGYTYIGYIKEGKTTSDFEVSNQEKSAATPTKQQKVDYNVTPNFVDHPSTVQAIQEQTPV
SSTKPTEVQVVEKPFSTELINPRKEEKQSSDSQEQLAEHKNLETKKEEKISPKEKTGVNT
LNPQDEVLSGQLNKPELLYREETIETKIDFQEEIQENPDLAEGTVRVKQEGKLGKKVEIV
RIFSVNKEEVSREIVSTSTTAPSPRIVEKGTKKTQVIKEQPETGVEHKDVQSGSIVEPAI
QPELPEAVVSDKGEPEVQPTLPEAVVTDKGETEVQPESPDTVVSDKGEPEQVAPLPEYKG
NIEQVKPETPVEKTKEQGPEKTEEVPVKPTEETPVNPNEGTTEGTSIQEAENPVQPAEES
TTNSEKVSPDTSSENTGEVSSNPSDSTTSVGESNKPEHNDSKNENSEKTVEEVPVNPNEG
TVEGTSNQETEKPVQPAEETQTNSGKIANENTGEVSNKPSDSKPPVEESNQPEKNGTATK
PENSGNTTSENGQTEPEKKLELRNVSDIELYSQTNGTYRQHVSLDGIPENTDTYFVKVKS
SAFKDVYIPVASITEEKRNGQSVYKITAKAEKLQQELENKYVDNFTFYLDKKAKEENTNF
TSFSNLVKAINQNPSGTYHLAASLNANEVELGPDERSYIKDTFTGRLIGEKDGKNYAIYN
LKKPLFENLSGATVEKLSLKNVAISGKNDIGSLANEATNGTKIKQVHVDGVLAGERGVGG
LLAKADQSSIAESSFKGRIVNTYETTDAYNIGGLVGHLTGKNASIAKSKATVTISSNTNR
SDQTVGGLAGLVDQDAHIQNSYAEGDINNVKHFGKVAGVAGYLWDRTSGEEKHAGELTNV
LSDVNVTNGNAITGYHYTGMKVANTFSSKANRVFNVTLEKDEVVSKESFEERGTMLDASQ
IVSKKAEINPLTLPTVEPLSTSGKKDSDFSKIAHYQANRALVYKNIEKLLPFYNKSTIVK
YGNLVKENSLLYQKELLSAVMMKDDQVITDIVSNKQTANKLLLHYNDHSSEKFDLKYQTD
FANLAEYNLGNTGLLYTPNQFLYDRDSIVKEVLPELQKLDYQSDAIRKTLGISPEVKLTE
LYLEDQFSKTKQNLGDSLKKLLSADAGLASDNSVTRGYLVDKIKNNKEALLLGLTYLERW
YNFNYGQVNVKDLVMYHPDFFGKGNTSPLDTLIELGKSGFNNLLAKNNVDTYGISLASQH
GTTDLFSTLEHYRKVFLPNTSNNDWFKSETKAYIVEEKSTIEEVKTKQGLAGTKYSIGVY
DRITSATWKYRNMVLPLLTLPERSVFVISTMSSLGFGAYDRYRSSDHKAGKALNDFVEEN
ARETAKRQRDHYDYWYRILDEQSREKLYRTILLYDAYKFGDDTTSGKATAEAKFDSSNPA
MKNFFGPVGNKVVHNQHGAYATGDGVYYMSYRMLDKDGAITYTHEMTHDSDQDIYLGGYG
RRNGLGPEFFAKGLLQAPDQPSDATITINSILKHSKSDSTEGSRLQVLDPTERFQNAADL
QNYVHNMFDLIYMMEYLEGQSIVNKLSVYQKMAALRKIENKYVKDPADGNEVYATNVVKE
LTEAEARNLNSFESLIDHNILSAREYQSGDYERNGYYTIKLFAPIYSALSSEKGTPGDLM
GRRIAYELLAAKGFKDGMVPYISNQYEEDAKQQGQTINLYGKERGLVTDELVLKKVFDGK
YKTWAEFKTAMYQERVDQFGNLKQVTFKDPTKPWPSYGTKTINNVDELQALMDQAVLKDA
EGPRWSNYDPEIDSAVHKLKRAIFKAYLDQTNDFRSSIFENKK
NT seq 5892 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtattttggtgaaaaacaagagcgtttttcatttagaaaattatcagtagga
cttgtatctgcaacgatttcaagtttattttttatgtctgtattagctagttcatctgtg
gatgctcaagaaactgcgggagttcactataaatatgtggcagattcagagctatcatca
gaagaaaagaagcagcttgtctatgatattccgacatacgtggagaatgatgatgaaact
tattatcttgtttataagttaaattctcaaaatcaactggcggaattaccaaatactgga
agcaagaatgagaggcaagccctagttgctggtgctagcttagctgctctgggaatttta
atttttgctgtttccaagaaaaaggttaagaataaaacggtattacatttagtattggtt
gcgggaatgggaaatggtgtcttagtttcagtccatgctttagaaaatcatcttttgcta
aattacaatacggactatgaattgacctctggagaaaaattacctcttcctaaagagatt
tcaggttacacttatattggatatatcaaagagggaaaaacgacttctgattttgaagta
agtaatcaagaaaaatcagcagccactcctacaaaacaacaaaaggtggattataatgtt
acaccaaattttgtagaccatccatcaacagtacaagctattcaggaacaaacacctgtt
tcttcaactaagccgacagaagttcaagtagttgaaaaacctttctctactgaattaatc
aatccaagaaaagaagagaaacaatcttcagattctcaagaacaattagccgaacataag
aatctagaaacgaagaaagaggagaagatttctccaaaagaaaagactggggtaaataca
ttaaatccacaggatgaagttttatcaggtcaattgaacaaacctgaactcttatatcgt
gaggaaactatagagacaaaaatagattttcaagaagaaattcaagaaaatcctgattta
gctgaaggaactgtaagagtaaaacaagaaggtaaattaggtaagaaagttgaaatcgtc
agaatattctctgtaaacaaggaagaagtttcgcgagaaattgtttcaacttcaacgact
gcgcctagtccaagaatagtcgaaaaaggtactaaaaaaactcaagttataaaggaacaa
cctgagactggtgtagaacataaggacgtacagtctggatctattgttgaacccgcaatt
cagcctgagttgcccgaagctgtagtaagtgataaaggcgaaccagaagttcaaccgaca
ttacccgaagcagttgtgaccgacaaaggtgagactgaggttcaaccagagtcgccagat
actgtggtaagtgataaaggtgaaccagagcaggtagccccattgccagaatataagggt
aatattgagcaagtaaaacctgaaactccggttgagaagaccaaagaacaaggtccagaa
aaaactgaagaagttccagtaaaaccaacagaagaaacaccagtaaatccaaatgaaggt
actacagaaggaacctcaattcaagaagcagaaaatccagttcaacctgcagaagaatca
acaacgaattcagagaaagtatcaccagatacatctagcgaaaatactggggaagtgtcc
agtaatcctagtgattcgacaacctcagttggagaatcaaataaaccagaacataatgac
tctaaaaatgaaaattcagaaaaaactgtagaagaagttccagtaaatccaaatgaaggc
acagtagaaggtacctcaaatcaagaaacagaaaaaccagttcaacctgcagaagaaaca
caaacaaactctgggaaaatagctaacgaaaatactggagaagtatccaataaacctagt
gattcaaaaccaccagttgaagaatcaaatcaaccagaaaaaaacggaactgcaacaaaa
ccagaaaattcaggtaatacaacatcagagaatggacaaacagaaccagagaaaaaactc
gaattaagaaatgtttctgatattgagttgtatagtcagacgaatggaacctacagacaa
catgtttcattggatggaattccagagaatacggatacttactttgtcaaggtaaaatct
tcagcatttaaagatgtctatataccagtagcttcaataactgaagagaaaagaaatggg
cagtcagtttataaaatcacagccaaagctgagaaactccagcaagaactagaaaataaa
tatgtcgacaatttcaccttctacctcgataagaaggctaaagaggaaaatacaaacttt
acttcctttagcaacctggtcaaagctataaaccaaaatccctctggaacctatcattta
gcggccagcctgaatgctaacgaagtggagcttggtcctgatgaaagatcctatatcaag
gacacctttactggtcgtttaatcggtgaaaaagatggcaagaattatgctatctataat
ttgaaaaaacctctgtttgaaaacttgagtggtgctacagtagaaaaactgagtctaaaa
aatgttgctatttcagggaaaaatgatattggttcactagcaaatgaagctacgaatggc
acaaagattaaacaagttcatgttgatggtgttctggctggagaacgtggtgtcggtggt
ttgttggctaaggcagaccaatcaagcatcgcagagagcagtttcaagggaagaattgtc
aatacctatgaaacgactgatgcctacaatattggcggtctggtcggtcatttaacagga
aaaaatgcgtctattgctaaatccaaagcgacagtaaccatttcgtcaaacaccaatagg
tcagatcagactgtcggtggtcttgcaggtctagtagaccaagatgcgcatatacagaac
agttatgcggaaggtgatattaataatgtcaagcactttggtaaagtcgctggtgtggca
ggatatttgtgggatcgaacttctggtgaggaaaaacacgctggtgaattgaccaatgtt
cttagcgatgtcaatgtaacaaacggaaatgccatcactggataccactatacaggaatg
aaggtagctaatacatttagtagtaaggctaatagagttttcaatgtcactttagagaag
gatgaggtcgtcagcaaggaatcctttgaagaaagaggaacaatgctagatgcttctcaa
attgtaagcaaaaaagcagaaataaatcctctcactctaccaacggtggaacccctctca
acaagtggcaagaaagacagtgatttttctaagatagcccattatcaagctaaccgtgct
ttggtttataagaacattgaaaaattgttacctttttataataagtcaaccatcgtcaaa
tacggaaacctggttaaggagaacagtctcttataccaaaaagaactcttatctgcagtt
atgatgaaggatgaccaagtaatcacagatattgtttccaacaaacagactgcaaacaaa
ctcttacttcactataatgaccattcatctgagaaatttgatctcaagtaccagactgat
tttgccaatctagcagaatataatctaggtaatacgggacttctctacactcctaaccaa
ttcttatatgatcgagactctattgttaaggaagtcttgcctgagttgcagaagcttgat
taccagtcagatgctatcagaaagacacttggtatttctccagaagttaagttaaccgag
ctctatttagaagaccagttctccaaaacaaaacaaaatctgggagacagcttgaaaaaa
cttttgtcagcagatgccggtctagctagcgataactcagtcaccagaggctatcttgta
gataaaatcaagaataataaggaagccttgctactcggtttaacttatttagaacgttgg
tataactttaactatggtcaagtgaatgtcaaagacctagttatgtatcatccagacttc
tttggtaaaggaaatacttccccactagatactctgattgagttaggtaaatctggcttt
aacaatcttctagctaagaataatgtcgatacttatggtatcagtcttgccagtcaacat
ggaacgacagatttgtttagcacgctggaacattaccgaaaagtctttttaccaaataca
agcaataatgactggtttaaatcagagactaaggcttacattgtcgaagaaaaatccact
atcgaagaggtgaaaacgaagcaagggttagctggcaccaagtattctatcggtgtttat
gatcgtatcacgagtgccacatggaaataccgcaatatggtcttgcctctcctgaccttg
ccagagagatccgtatttgtcatctcgaccatgtctagtctaggatttggagcttatgat
cgctaccgcagtagtgaccataaagcgggcaaggctctcaatgattttgttgaagaaaat
gcgcgtgaaacagccaaacgtcagcgagatcactacgattattggtatcgtattttagat
gaacagtcacgcgaaaaactctatcgtacgattctcctttatgatgcctataagtttggg
gatgacacaacatcaggaaaagctacagcggaggctaagtttgatagctccaatccagct
atgaagaacttctttggaccagttggcaataaggtagtacacaaccagcatggagcctac
gctacaggggacggcgtctactatatgtcttaccgcatgctggacaaggatggagccatt
acttatacccatgaaatgacccatgattcggatcaggatatttaccttggtggctatggt
cgaagaaatggcttgggaccagagttcttcgcaaaaggcttattgcaagcccctgaccaa
ccaagtgacgcaaccattaccattaattctatcttgaaacactcaaaatcagatagtaca
gagggatcccgtcttcaagtcttggatccgacagagagattccaaaacgcagcagatctt
cagaactatgtccataacatgtttgaccttatctacatgatggaatatctcgaagggcag
tcaatcgttaataaactaagtgtttaccagaaaatggcggctctcagaaaaattgagaac
aagtatgtgaaagatccagcagatggaaatgaggtttatgccactaacgtagtcaaagaa
ttgacagaagcagaggcccgaaacctgaatagttttgaaagtttgattgaccacaacatc
ttatcagctcgtgagtaccagtctggcgactatgaacgaaatggctactataccatcaaa
ctctttgccccaatctattcagctctcagcagtgagaaaggcacaccaggggaccttatg
ggacgtaggattgcgtacgaacttttggctgccaaaggctttaaggatggaatggtacct
tatatctcaaaccaatacgaagaagatgctaaacaacaagggcaaactatcaatctttat
ggtaaagaacggggcttggtgaccgatgagcttgttttgaaaaaggtatttgacggtaag
tataaaacttgggcagaatttaagacagctatgtaccaagaacgagtggatcagtttgga
aacttgaagcaggtgacctttaaagatccgacaaaaccatggccaagctatggcacaaag
actatcaataatgtggatgaattgcaagccctcatggaccaagctgttctcaaggatgct
gaaggtccacgttggagtaattatgatccagaaatcgacagtgccgttcataagttgaag
agagcaatctttaaagcctatcttgaccaaacaaatgattttagaagttcaatttttgag
aataaaaaatag

DBGET integrated database retrieval system