KEGG   Streptococcus pneumoniae INV104 (serotype 1): INV104_17310Help
Entry
INV104_17310      CDS       T02072                                 

Definition
(GenBank) RNA pseudouridylate synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sni  Streptococcus pneumoniae INV104 (serotype 1)
Brite
KEGG Orthology (KO) [BR:sni00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sni03009]
    INV104_17310
Enzymes [BR:sni01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     INV104_17310
Ribosome biogenesis [BR:sni03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    INV104_17310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 PA14
Motif
Other DBs
NCBI-ProteinID: CBW37412
Position
1900086..1900922
Genome map
AA seq 278 aa AA seqDB search
MTVKQLLEEQLLIPRKIRHFLRIKKHILINQEEVHWNEIVNPGDVCQLTFDEEDYPQKTI
PWGNPDLVQEVYQDQYLIIVNKPEGMKTHGNQPNEIALLNHVSTYVGQTCYVVHRLDMET
SGLVLFAKNPFILPILNRLLEKKEISREYWALVDGNINRKELVFRDKIGRDRHDRRKRIV
DAKNGQYAETYVSRLKQFSNKTSLARCKLKTGRTHQIRVHLSHHNLPILGDPLYNSKSKT
SRLMLHAFRLSFTHPLTLEKLTFTTLSNTFEKELKKNG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacggtaaagcaattacttgaggaacaactcctcatccctagaaaaatccgtcatttt
ttgagaatcaagaaacatattttgataaatcaagaagaagtccactggaacgaaatcgta
aatcctggagatgtttgccagttgacttttgacgaggaagattatccccaaaagacgatc
ccttggggcaacccagacttagtgcaggaagtttatcaagatcaatacttgattattgta
aacaaaccagaggggatgaaaacgcatggtaatcaaccaaacgaaattgcccttcttaac
catgtcagtacctatgttggccaaacctgctatgtcgttcatcgtctggacatggaaacc
agtggcttagttctctttgccaaaaatccttttatcctgcccattctcaatcgcttattg
gagaaaaaagagatttctagagaatattgggctctagttgatggaaatatcaacagaaaa
gaacttgttttcagagacaaaattggacgtgatcgccatgatcgtagaaaaagaatagtt
gatgcaaaaaatgggcaatatgctgaaacgtatgtaagcagattaaagcaattctcaaac
aagacttccttggctcgttgcaagctaaagacagggcgaacccatcagattcgtgtgcac
ctttcgcatcataatcttcctatcctgggcgaccctctctataatagtaaatcaaagaca
agtcggcttatgcttcatgccttccgactttcctttacccacccacttactttagagaag
ctaactttcactaccctttcaaatacatttgaaaaagaattaaaaaagaatggatga

DBGET integrated database retrieval system