KEGG   Streptococcus pneumoniae INV104 (serotype 1): INV104_17610Help
Entry
INV104_17610      CDS       T02072                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
sni  Streptococcus pneumoniae INV104 (serotype 1)
Pathway
sni00430  Taurine and hypotaurine metabolism
sni00620  Pyruvate metabolism
sni00640  Propanoate metabolism
sni00680  Methane metabolism
sni01100  Metabolic pathways
sni01120  Microbial metabolism in diverse environments
sni01200  Carbon metabolism
Module
sni_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    INV104_17610 (ackA)
   00640 Propanoate metabolism
    INV104_17610 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    INV104_17610 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    INV104_17610 (ackA)
Enzymes [BR:sni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     INV104_17610 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: CBW37442
Position
complement(1929929..1931119)
Genome map
AA seq 396 aa AA seqDB search
MTKTIAINAGSSSLKWQLYLMPEEKVLAKGLIERIGLKDSISTVKFDGRSEQQILDIENH
TQAVKILLDDLIRFDIIKAYDEITGVGHRVVAGGEYFKESTVVEGDVLEKVEELSLLAPL
HNPANAAGVRAFKELLPDITSVVVFDTSFHTSMPEKAYRYPLPTKYYTENKVRKYGAHGT
SHQFVAGEAAKLLGRPLEDLKLITCHIGNGGSITAVKAGKSVDTSMGFTPLGGIMMGTRT
GDIDPAIIPYLMQYTEDFNTPEDISRVLNRESGLLGVSANSSDMRDIEAAVAEGNHEASL
AYEMYVDRIQKHIGQYLAVLNGTDAIVFTAGVGENAENFRRDVISGISWFGCDVDDEKNV
FGVTGDISTEAAKIRVLVIPTDEELVIARDVERLKK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacaattgcaatcaatgcaggaagttcaagtttgaaatggcaattatactta
atgccagaggaaaaagtgttagccaaaggtttgattgaacgtatcggtttgaaagattca
atttcaactgtaaaatttgacggccgttctgaacaacaaattttggatatcgaaaatcat
acacaagctgttaaaattttattggatgacttgattcgtttcgatattatcaaggcttat
gacgagattacaggtgttggccaccgtgttgtagcaggtggagaatatttcaaagaatca
acagttgttgagggagatgttttagaaaaagttgaagagttgagtttgttggctcctcta
cacaacccggccaatgcagcaggtgttcgtgctttcaaggaattgttgccagacattacc
agtgtagttgtttttgatacttccttccacacaagtatgccagagaaagcttatcgctac
cctctaccaacaaaatattacacagaaaacaaggttcgtaaatacggtgctcatggtaca
agtcaccagtttgtagcaggagaagctgcaaaactcttgggacgtccattagaagacttg
aagttaattacctgtcatattggtaacggaggctcaattacagctgtgaaagccggcaaa
tctgtagacacttctatggggttcactcctcttggtggtattatgatgggaacgcgtaca
ggggatattgatccagctatcattccttatttaatgcaatatacagaggattttaacaca
ccagaagatatcagtcgtgttcttaaccgtgaatcaggtcttttgggagtttctgctaat
tctagcgatatgcgcgatatagaagcagctgtagcagaagggaatcacgaggctagcttg
gcttatgaaatgtatgttgaccgtatccaaaaacatatcggtcagtaccttgcagtgcta
aatggaacagatgccattgttttcacagcaggtgtcggtgaaaatgcagagaatttccgt
cgtgatgtaatctcagggatttcgtggtttggttgtgatgttgatgatgaaaagaatgtc
tttggcgttacaggagacatctcaacagaggcagctaaaatccgtgtcttggttattcca
acagatgaagaattagtcattgcccgtgacgttgaacgcttgaaaaaataa

DBGET integrated database retrieval system