KEGG   Sphingomonas sp. NIC1: A7E77_09585Help
Entry
A7E77_09585       CDS       T04479                                 

Definition
(GenBank) mannose-1-phosphate guanyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
snj  Sphingomonas sp. NIC1
Pathway
snj00051  Fructose and mannose metabolism
snj00520  Amino sugar and nucleotide sugar metabolism
snj01100  Metabolic pathways
snj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A7E77_09585
   00520 Amino sugar and nucleotide sugar metabolism
    A7E77_09585
Enzymes [BR:snj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     A7E77_09585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: ANC87128
Position
complement(1995905..1996888)
Genome map
AA seq 327 aa AA seqDB search
MSSPETPKQLLPLTADETMLQLTARRAHGEAFAAPIVVANARHADAIDEQLAAADAKPQA
VILEPVGRNTAPAIALAALAAGAEDALLVMPSDHVIADVEAFRAAVDAAMPMVADGWLVT
FGIAPDAPETGYGWIQVGDPLAEGVHRVARFVEKPPRDRAEAMLAAGDHVWNGGIFLFRA
DMFLGALAAHAPAILTAAQTAMRQARREGVRIYPDAEAFGASPSDSIDYAVMERADRVAV
VPVAMGWSDVGSWDALLAISPCDERGNHHRGEVLAIDTNNCLIRSDGVRISAVGVSDLIV
VACGNDVMIVPRGRSQDVKKLIEAMQK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcccagaaacgcccaagcagctgctgccgctgacggcggacgagacgatgcta
cagctgaccgcacgacgggcgcatggcgaggcgtttgcggcgccgatcgtcgtggccaat
gcgcggcatgccgatgcgatcgacgaacagctcgccgccgccgacgctaagccgcaggcg
gtgatcctggaaccggtcggccgcaacaccgcgcccgcgatcgcgctggcggcgctggcg
gcgggggcagaggacgcgctgctcgtcatgccgtccgatcacgtcatcgccgatgtcgag
gcattccgtgccgcggtggacgccgcgatgccgatggtcgcggatggctggctggtgacg
ttcgggatcgcgcccgatgcgcccgaaaccggctatggctggatccaggtgggcgaccca
ctggccgaaggcgtgcatcgcgtcgcgcgcttcgtcgaaaagccgccgcgcgaccgtgcc
gaggcgatgctggcggcgggcgaccatgtgtggaacggcggcatcttcctgttccgcgcc
gacatgttcctgggcgcgctggcggcgcatgccccggcgatcctgaccgccgcgcagacg
gcgatgcggcaggcccgacgcgagggcgtgcggatttatccggatgcggaggcgttcggg
gcgtcgccgtcggattcgatcgactatgcggtgatggaacgcgccgatcgcgtcgcggtg
gtgccggtggcgatgggttggagcgacgtcggtagctgggacgcgctgctcgcgatcagc
ccgtgcgacgagcggggcaaccaccaccgcggcgaggtgctggcgatcgacacgaacaat
tgcctgatccgatcagacggcgtccgcatctcggcggtgggcgtcagcgatctgatcgtg
gtggcgtgcggcaacgacgtgatgatcgtgccgcgcggtcgcagccaggacgtcaagaaa
ctgatcgaggcgatgcagaagtaa

DBGET integrated database retrieval system