KEGG   Sphingomonas sp. NIC1: A7E77_10415Help
Entry
A7E77_10415       CDS       T04479                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
snj  Sphingomonas sp. NIC1
Pathway
snj00071  Fatty acid degradation
snj00072  Synthesis and degradation of ketone bodies
snj00280  Valine, leucine and isoleucine degradation
snj00310  Lysine degradation
snj00362  Benzoate degradation
snj00380  Tryptophan metabolism
snj00620  Pyruvate metabolism
snj00630  Glyoxylate and dicarboxylate metabolism
snj00640  Propanoate metabolism
snj00650  Butanoate metabolism
snj00900  Terpenoid backbone biosynthesis
snj01100  Metabolic pathways
snj01110  Biosynthesis of secondary metabolites
snj01120  Microbial metabolism in diverse environments
snj01130  Biosynthesis of antibiotics
snj01200  Carbon metabolism
snj01212  Fatty acid metabolism
snj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:snj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A7E77_10415
   00630 Glyoxylate and dicarboxylate metabolism
    A7E77_10415
   00640 Propanoate metabolism
    A7E77_10415
   00650 Butanoate metabolism
    A7E77_10415
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A7E77_10415
   00072 Synthesis and degradation of ketone bodies
    A7E77_10415
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A7E77_10415
   00310 Lysine degradation
    A7E77_10415
   00380 Tryptophan metabolism
    A7E77_10415
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A7E77_10415
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A7E77_10415
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A7E77_10415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:snj04147]
    A7E77_10415
Enzymes [BR:snj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A7E77_10415
Exosome [BR:snj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A7E77_10415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANC88406
Position
complement(2185023..2186192)
Genome map
AA seq 389 aa AA seqDB search
MAEAYIVQAVRTAGGRRGGRLAGWHPADMAGATLDAIVGRSGIDPAAIEDVIMGCVSQGG
EQSFQVGRGAVLASSLPTSVPAVTIDRQCGSSQQAIQFAAQAVMSGTQDVVIAAGVESMT
RVPMGSTGALFAQAGLGKAKSPRQEARFPGVQFSQFMGAEMIARKYGFDRAQLDAYALES
HRRAAAATEAGAFADEIVGLEVETPEGTVIHDRDEGIRYDATPESIGAVKLLQEGGAITA
ANASQICDGASAVMVVSEAALKAHGLTPLARIHNLTVTGGDPVVMLEEPLFATDRALQRA
GMRIDDIDLYEVNEAFAPVPLAWLQHTGGDPAKLNVNGGAIALGHPLGASGTKLMATLVH
ALHARGGRYGLQTMCEGGGIANVTIVERL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcctatatcgtccaggcggtgcggaccgcgggcggacggcgcggcgggcgg
ctggcgggctggcacccggcggacatggcaggagcgacgctcgacgcgatcgtcggacgg
agcggcatcgatcccgccgcgatcgaagacgtcatcatgggctgcgtcagccagggcggc
gaacagagcttccaggtcgggcgtggcgcggtgctcgcctcgtcgctgccgaccagcgtg
cccgccgtcacgatcgaccgccagtgcggatcgtcgcaacaggcgatccagttcgccgcg
caggcggtgatgagcgggacgcaggacgtcgtgatcgccgcgggcgtcgaaagcatgacg
cgcgtaccgatgggctcgaccggcgcgctgttcgcacaggccggcctcggcaaggcgaaa
agcccgcggcaggaggcgcgctttcccggcgtgcagttcagccagttcatgggcgccgag
atgatcgcgcgcaaatacggtttcgaccgggcccagctcgacgcctatgcgctcgaaagc
caccgccgcgctgctgcggcgaccgaggctggcgccttcgccgacgagatcgtcgggctg
gaggtggagacgcccgagggaacggtgatccacgaccgcgacgagggcatccgctacgac
gcgacgccggaaagcatcggcgcggtgaagctgttgcaggaaggcggcgcgatcaccgcc
gccaacgccagccagatctgcgacggcgcgagtgcggtcatggtggtgagcgaggcagcg
ctgaaggcgcatggcctgacgcccctcgcccgcatccacaatctgaccgtcaccggcggc
gatcccgtcgtgatgctggaagagccgttgttcgccacggatcgcgccttgcagcgcgcc
gggatgcggatcgacgacatcgacctgtatgaggtgaacgaggctttcgcgccggtgccg
ctcgcctggttgcagcataccggcggcgatccggcgaagctcaacgtcaatggcggggcg
atcgctctcggccatccgctcggcgcgtcgggcacgaagctgatggcgacgctggtccac
gcgctgcacgcgcgcggcgggcggtacggcttgcagacgatgtgcgaaggcggcggcatc
gccaacgtcacgatcgtcgagcggctgtaa

DBGET integrated database retrieval system