KEGG   Sphingomonas sp. NIC1: A7E77_14045Help
Entry
A7E77_14045       CDS       T04479                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
snj  Sphingomonas sp. NIC1
Pathway
snj00480  Glutathione metabolism
snj00590  Arachidonic acid metabolism
snj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    A7E77_14045
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A7E77_14045
Enzymes [BR:snj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     A7E77_14045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ANC87915
Position
2983487..2983966
Genome map
AA seq 159 aa AA seqDB search
MSSITDLTVRGADGNPLSLDRWAGQVLLIVNTASKCGFTPQYEGLEALHRRFADKGFEVL
AFPCNQFGAQEPGDAAEIANFCSLTYDVTFPVFAKIDVNGAAADPLFERLKTAAPGVLGS
KAIKWNFTKFLVDRSGQVVRRYAPTTKPEDLAADIKALL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcatcaccgatctgaccgtgcggggcgcggacggcaacccgctgtcgctggac
cgctgggcggggcaggtgctgctgatcgtcaacaccgcgtcgaaatgcgggttcactccg
cagtacgaggggctggaggcgctgcatcggcggttcgccgacaaggggttcgaggtgctg
gcctttccctgcaaccagttcggcgcgcaggagccgggcgatgcggcggagatcgcgaat
ttctgttcgctgacctatgacgtgacgtttccggtgttcgccaagatcgacgtcaacggt
gcggcggccgatccgttgttcgaacggctgaagacggcggcgcccggcgtgctggggtcg
aaggcgatcaagtggaacttcaccaagttcctggtggatcggtcgggccaggtcgtgcgg
cgctatgcgccgacgacgaagcccgaggatcttgcggcggatatcaaggcgttgctgtag

DBGET integrated database retrieval system