KEGG   Staphylococcus nepalensis: BJD96_04000Help
Entry
BJD96_04000       CDS       T05272                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
snl  Staphylococcus nepalensis
Pathway
snl00051  Fructose and mannose metabolism
snl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BJD96_04000
Enzymes [BR:snl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     BJD96_04000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N Sacchrp_dh_NADP NAD_Gly3P_dh_N RNA_pol_Rpb4 UDPG_MGDP_dh_N DUF1829
Motif
Other DBs
NCBI-ProteinID: ATH59555
UniProt: A0A291JJ22
Position
complement(893164..894267)
Genome map
AA seq 367 aa AA seqDB search
MKALHFGAGNIGRGFIGYILADNDIKVTFADVNAEIIDALDAKHEYDVILADQAHTTTRV
HNVDAINSGQPSESLKQAVLEADLITTAVGVNVLPIIAKTFAPYLKEKETPVNIVACENA
IMATNTLKDAILDITGPLGDHIHFANSAVDRIVPLQTNEHILDVVVEPFYEWVVEKDAWF
GPELNHIKYVENLTPYIERKLLTVNTGHAFLAYAGRFFGQPTILDAVKDAHIKHDLERVL
EETSQYITNQFDFTVAEQAQYVEKIIKRFKNPNLSDEVTRVGRGTIRKIGPQDRIVKPLN
YLYQNNLKHDALVKAAALLLKYDDTNDQETVEKNDYIKEHGIEAFLKDYAKIDDQLVAEI
VKAYNVL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggtgctggtaacattggccgaggctttataggttatatttta
gctgataatgatattaaagttacatttgcagatgttaatgctgaaattatcgatgcttta
gatgctaaacatgaatatgacgttatcctagcagatcaagcacatacaacgactcgcgtg
cataatgtggacgccatcaattcaggacaaccttctgaaagtttaaaacaagcagtatta
gaagcggatttaattactactgcagtaggcgtcaatgttttacctattattgccaaaaca
tttgcgccctatttaaaagaaaaagaaaccccagtaaacattgttgcttgtgaaaatgca
attatggcaacgaatactttaaaagatgcgatattagatatcactggccctttaggtgat
cacatccattttgcaaactcagcagttgatagaattgttcctctacaaaccaatgagcac
attttagatgtggtagttgaacctttctacgaatgggtcgtagaaaaagatgcatggttt
ggtcccgaattaaatcatataaaatatgttgagaacttaacgccatacattgaaagaaag
ttattaacagtaaacacagggcatgctttcttagcttacgctggtagattttttggccaa
ccaaccattttagatgcagtgaaagatgctcatattaaacatgatttagaacgtgtactt
gaagaaacaagccaatatattacaaatcaatttgattttacagtggcagaacaagcacaa
tatgttgagaaaatcatcaagcgtttcaaaaaccctaatctttcagatgaagtaacacgt
gtaggacgtggaacaatccgtaaaattggaccacaagatagaattgttaaaccattaaat
tacttatatcagaataatttaaaacatgacgctttagttaaagctgctgcgttacttcta
aaatacgatgatacaaatgaccaagaaacagtagaaaaaaatgactatattaaagaacat
ggcatcgaagcattcttaaaagattatgctaaaattgatgaccaattagttgctgaaatc
gttaaagcttacaatgtactgtaa

DBGET integrated database retrieval system