KEGG   Staphylococcus nepalensis: BJD96_08405Help
Entry
BJD96_08405       CDS       T05272                                 

Definition
(GenBank) methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO
  KO
K04094  methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
snl  Staphylococcus nepalensis
Brite
KEGG Orthology (KO) [BR:snl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:snl03016]
    BJD96_08405
   03036 Chromosome and associated proteins [BR:snl03036]
    BJD96_08405
Enzymes [BR:snl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.74  methylenetetrahydrofolate---tRNA-(uracil54-C5)-methyltransferase (FADH2-oxidizing)
     BJD96_08405
Transfer RNA biogenesis [BR:snl03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    BJD96_08405
Chromosome and associated proteins [BR:snl03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BJD96_08405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIDA NAD_binding_8 Pyr_redox_2 DAO FAD_binding_2 Pyr_redox 3HCDH_N HI0933_like FAD_binding_3 FAD_oxidored Thi4 AlaDh_PNT_C Lycopene_cycl ThiI
Motif
Other DBs
NCBI-ProteinID: ATH60321
UniProt: A0A291JKB0
Position
complement(1784945..1786252)
Genome map
AA seq 435 aa AA seqDB search
MSQIVNVIGAGLAGSEAAYQLAQRGIKVNLIEMRPVKQTPAHHTDKFAELVCSNSLRGNA
LTNAVGVLKEEMRRMGSLIITAADKARVPAGGALAVDRHDFAGYITDTLKKHPNITVINE
EINSIPEGYTIIATGPLTTNQLATEIVEVTGKDQLYFYDAAAPIVEKDSIDMDKVYLKSR
YDKGEAAYLNCPMTEDEFNRFYDALLEAEVAPVNEFEKEKYFEGCVPFEVMAARGRKTLL
FGPMKPVGLENPRTGELPYAIVQLRQDDAAGTLYNLVGFQTHLKWGAQKEVLKLIPGLEN
VEIVRYGVMHRNTFINSPDVLTETYELKGREKLHFAGQMTGVEGYVESAASGLIAGINVA
HKIENKGKVIFPRETMLGSMAYYISHAKNEKNFQPMNANFGLLPSLDEKIKDKKARYEQL
AHRALTYLDNYKQTL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaattgtcaatgttataggggctggtctagctggttcagaagcggcataccaa
ttagctcaaagaggtataaaggtgaatttaattgaaatgagaccggtgaagcaaacgcca
gcacatcatacagataaatttgccgaactagtctgctctaattcattacgtggtaacgca
ttgactaatgctgttggtgtattgaaagaagaaatgaggcgcatgggttcactcatcatt
actgcagctgataaagcacgtgttccagccggtggtgcgttagctgttgatcgacacgat
tttgctggttacattactgacacattaaaaaagcatcctaacataactgtaatcaatgaa
gaaataaacagtataccagagggttatactattattgcaactggaccattaacaactaac
caactagcgactgaaattgtagaagttactggtaaagaccaattatacttttatgacgca
gcagcgcctatagttgaaaaagatagtattgatatggataaagtttatttaaaatctcgt
tatgataaaggtgaagctgcttatttgaattgtccaatgactgaagatgaatttaatcga
ttctacgatgcattgctagaagctgaagtagcgccagtaaatgagttcgaaaaagaaaaa
tattttgaagggtgtgtgccttttgaagttatggcagcacgtgggcgcaaaacattgtta
ttcggacctatgaaaccagtagggttggaaaatcctagaactggagaacttccgtatgca
attgtgcagttacggcaagatgatgcagcaggaacattgtataacttagtaggtttccaa
acgcatttgaagtggggtgctcaaaaagaagtgctcaaactaatcccaggcttagaaaat
gttgaaattgttagatatggtgtcatgcatagaaatacttttatcaattctccagacgtt
ttaactgaaacttatgaattaaaaggaagagaaaaacttcatttcgctggtcaaatgact
ggcgtagaaggctacgtagaaagtgctgcaagtggtttaatcgctggtatcaatgtcgct
cataaaatcgaaaataaagggaaagttatttttcctagagaaacgatgctaggcagcatg
gcttattatatttcacatgcgaaaaacgaaaaaaacttccagccaatgaatgctaatttt
ggtttattaccatctttagacgaaaaaattaaagataaaaaagcccgttatgaacaactt
gctcacagagcattaacatatttagataattataaacaaacattgtag

DBGET integrated database retrieval system