KEGG   Staphylococcus nepalensis: BJD96_14020Help
Entry
BJD96_14020       CDS       T05272                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
snl  Staphylococcus nepalensis
Pathway
snl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:snl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BJD96_14020
Enzymes [BR:snl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BJD96_14020
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BJD96_14020
    1.1.1.-  
     BJD96_14020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ATH61445
UniProt: A0A291JP69
Position
pSNJS101:complement(36925..37962)
Genome map
AA seq 345 aa AA seqDB search
MKAAVWYGQKDVRVEDRKSKELQDNEVKVKVSWAGICGTDLHEYLEGPIFISTDKPDPFL
GQKAPVTLGHEFAGVVYDIGSKVTKFNKGDRVVINPTVSNREKEENIDLYDGYSFIGLGS
DGGFAEFTNAPEENVYKLPDNVSDKEGALVEPTAVAVQAIKEGEVLFGDTVAIFGVGPIG
LLTTIAAKAAGASKIFVFDLSEERLNKAKAIGATHTINSGESNPSDVINKHTDNGVDVAF
EVAGVASTLKSAIDVTKARGTVVIVSIFGHPIEWNPMQLTNTGVKLTSTIAYTPTTFQQT
IDLIKEGNLKVNDVVTDEIELDDIVESGFKQLVNDKSQAKILVKL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtttggtatggtcaaaaggatgtacgagttgaagatcgaaaatctaaa
gagttacaagataatgaggttaaagttaaagtgtcttgggctggcatttgtgggacagat
ttacatgaatacttagaaggccctatatttatttcaacagacaaacctgacccgttcctt
ggccaaaaagcgcccgttacattaggccatgaatttgcaggtgtagtatatgatattggt
tctaaggttacaaaatttaataaaggcgatcgtgttgtcattaatcctacagtttcaaat
cgtgaaaaagaagaaaatattgatctttatgatggttattcatttataggcttaggttct
gatggtggatttgcagaatttacaaacgccccagaagagaatgtttataaattaccagat
aatgtttctgataaagaaggcgcccttgtagaaccgacggctgttgcagttcaagcaatt
aaagaaggcgaagttctatttggcgatactgttgctatttttggtgtagggccaatcggt
ttattaacaactatagcagccaaagctgcaggtgcgagtaagatatttgtttttgattta
tcagaagaaagattgaataaagctaaagcaataggtgctactcatactattaattctggt
gaatcaaacccaagtgatgttattaataaacatacagataatggagttgatgtagcattt
gaagtagctggtgtagcatcaacacttaaatctgctatagacgttactaaagcaagaggt
actgtcgttatagtgtctatatttggtcatcctattgaatggaatccaatgcaattaaca
aatacaggtgtaaagctcacttcgacaattgcttatacacctactacatttcaacaaaca
atagatttaattaaagaaggtaatttaaaagttaacgatgtcgttactgatgagatagag
ttagatgatattgtggagtcaggatttaaacaacttgtaaacgataaatcacaagcaaaa
attctcgttaagttataa

DBGET integrated database retrieval system