KEGG   Streptococcus pneumoniae 70585 (serotype 5): SP70585_0507Help
Entry
SP70585_0507      CDS       T00872                                 

Gene name
gatC
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, C subunit
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
snm  Streptococcus pneumoniae 70585 (serotype 5)
Pathway
snm00970  Aminoacyl-tRNA biosynthesis
snm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SP70585_0507 (gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:snm03029]
    SP70585_0507 (gatC)
Enzymes [BR:snm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SP70585_0507 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SP70585_0507 (gatC)
Mitochondrial biogenesis [BR:snm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SP70585_0507 (gatC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: ACO16072
UniProt: C1C5H3
Position
complement(454785..455087)
Genome map
AA seq 100 aa AA seqDB search
MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT
VLRPDVAEEGTDRDRLFKNVPEQDNYYIKVPAILDDGGDA
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattacgcaagaagaggtaacacacgttgccaatctttcaaaattaagattctct
gaagaagaaactgctgcctttgcgaccaccttgtctaagattgttgacatggttgaattg
ctgggcgaagttgacacaactggtgtcgcacctactacgactatggctgaccgcaagact
gtactccgccctgatgtggccgaagaaggaacagaccgtgatcgcttgtttaaaaacgta
cctgaacaagacaactactatatcaaggtgccagctatcctagacgatggaggagatgcc
taa

DBGET integrated database retrieval system