KEGG   Streptococcus pneumoniae 70585 (serotype 5): SP70585_1093Help
Entry
SP70585_1093      CDS       T00872                                 

Gene name
metG2
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
snm  Streptococcus pneumoniae 70585 (serotype 5)
Pathway
snm00450  Selenocompound metabolism
snm00970  Aminoacyl-tRNA biosynthesis
snm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SP70585_1093 (metG2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SP70585_1093 (metG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:snm01007]
    SP70585_1093 (metG2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:snm03016]
    SP70585_1093 (metG2)
Enzymes [BR:snm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SP70585_1093 (metG2)
Amino acid related enzymes [BR:snm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SP70585_1093 (metG2)
Transfer RNA biogenesis [BR:snm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SP70585_1093 (metG2)
 Prokaryotic type
   Other AARSs
    SP70585_1093 (metG2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 Laminin_EGF PolC_DP2 YfmQ
Motif
Other DBs
NCBI-ProteinID: ACO17449
UniProt: C1C727
Position
1003290..1004927
Genome map
AA seq 545 aa AA seqDB search
MSIFIGGAWPYANGSLHIGHAAALLPGDILARYYRQKGEEVLYVSGSDCNGTPISIRAKK
ENKSVKEIADFYHKEFKETFEKLGFTYDLYSRTDSPLHHEIVQELFLQLYEKKFLYTKKI
KQLYCTFDNQFLPDRFVEGKCPNCGTHSRGDQCDNCSAILDPIDLVDKRCSICSNEPEVR
ETEHFYYVFSEFQNLLETYLNDAEETVRWRKNAINLTKRYLREGLPDRAVTRDLPNGIPV
PIDGFRDKKIYVWFEAVAGYYTASVDWAQKLQNNITDFWNNRTKSYYVHGKDNIPFHTII
WPAILSGLEIEPLPEYIISSEYLTLENKKISTSNNWAIWLNDIIKKYDADSIRYFLTINA
PEMKDANFSWREFIYSHNSELLGSYGNFINRTLKFIEKYFESEIPTKYLEGEILYNLKEL
YTTVGNLVESGHMKQALEEIFEYIRSANKFYDDMKPWALRESDIEKCKEVLATCVIIILN
LGQMLNPFIPFSGKKIEDMFKTKLNTWNYISNLPNKLSDVSMLFDRIDLKKIDEEVLELQ
QTSSR
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttttattggaggagcatggccatatgcaaacggttcgttacatattggtcac
gcggcagcgcttttaccgggggatattcttgcaagatactatcgtcagaagggagaggaa
gttttatatgtttctggaagtgattgtaatggaacccctatttctatcagagctaaaaaa
gaaaataagtctgtgaaagaaattgctgatttttatcataaggaatttaaagaaactttt
gaaaaattaggttttacatatgacttgtactcgcgaacagattctccactacatcatgag
atagtacaagaattatttttgcaattatacgagaagaaatttttgtatacaaaaaaaatt
aaacaactctattgtacatttgataatcaattcttacctgataggttcgttgaaggaaaa
tgcccgaattgtggaacccattcaagaggagatcaatgtgataattgctcagcaatttta
gatcctatagatttagttgataaaagatgttctatttgttccaatgaaccagaagttcgt
gagacagaacacttttattatgtttttagtgagtttcaaaatttgttagagacttactta
aatgatgctgaagaaacagtgagatggcgaaaaaatgcaataaatctaactaaaaggtat
ttacgggaaggtttacctgatcgagctgttactcgtgatctaccaaatgggattccagtt
cccattgatggttttagagataaaaaaatatatgtctggtttgaagcggtagcaggttac
tacacagcaagtgttgattgggcgcaaaaacttcaaaataatattactgatttttggaac
aatcggacaaagtcatattatgttcatggaaaagataacatcccatttcatactattatt
tggccggcaatactctcaggtttagaaatagagcctcttccagagtatattatttctagt
gaatatttaacgttagaaaacaaaaaaatatcaacaagtaataattgggctatatggctt
aacgatatcataaaaaaatatgatgctgattcaatccgatacttcctaacaataaatgct
cctgagatgaaagatgcaaatttttcttggagagaatttatttatagtcataactcagaa
ttattaggatcgtacggtaattttatcaataggactctaaagtttattgaaaagtatttt
gaatctgaaatacccactaaatatctcgaaggagaaattttatataatttgaaagaatta
tatacaacagtaggtaatttagttgagagcgggcatatgaaacaggcattagaagaaatt
tttgaatatattagatcggctaataaattctatgatgatatgaaaccgtgggcattgcga
gagtccgatattgaaaaatgtaaagaagtcttagctacttgtgtaatcattatacttaat
ttaggacaaatgttaaatccattcattcctttttctggtaaaaagattgaggatatgttt
aaaacaaagctaaatacttggaattatatttcaaaccttcctaacaagctatcagatgta
tcaatgttgtttgataggattgatttgaaaaaaattgacgaggaagttttagaattgcaa
caaacatccagtagataa

DBGET integrated database retrieval system