KEGG   Streptococcus pneumoniae 70585: SP70585_1873Help
Entry
SP70585_1873      CDS       T00872                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
snm  Streptococcus pneumoniae 70585
Pathway
snm00260  Glycine, serine and threonine metabolism
snm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
snm01100  Metabolic pathways
snm01110  Biosynthesis of secondary metabolites
snm01130  Biosynthesis of antibiotics
snm01230  Biosynthesis of amino acids
Module
snm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:snm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SP70585_1873 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SP70585_1873 (trpB)
Enzymes [BR:snm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SP70585_1873 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACO17425
UniProt: C1C966
Structure
PDB: 

Position
complement(1739529..1740752)
Genome map
AA seq 407 aa AA seqDB search
MAYQEPNKDGFYGKFGGRFVPETLMTAVLELEKAYRESQADPSFQEELNQLLRQYVGRET
PLYYAKNLTQHIGGAKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGAGQHG
VATATAAALFNMECTIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSRVLKDAVNAALRS
WVANIDDTHYILGSALGPHPFPEIVRDFQSVIGREAKQQYRDLTGRDLPDALVACVGGGS
NAIGLFHPFVEDESVAMYGTEAAGLGVDTEHHAATLTKGRPGVLHGSLMDVLQDAHGQIL
EAFSISAGLDYPGIGPEHSHYHDIKRASYVPVTDEEALEGFQLLSRVEGIIPALESSHAI
AFAVKLAKELGPEKSMIVCLSGRGDKDVVQVKDRLEADAAKKGEAHA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcaggaaccaaataaagatggattttacggaaaattcggcggacgttttgtc
ccagaaacattgatgacagcagttttggagttggagaaggcctaccgtgaaagtcaggca
gacccaagtttccaagaggaattaaaccaacttttgcgccagtatgtgggacgtgaaact
cccctttactacgcaaaaaacttgacccagcatatcggcggagccaagatttatctcaaa
cgggaagaccttaaccatacaggagcccacaagattaacaatgccttaggacaagtttgg
cttgccaaacgtatgggtaaaaagaaaattatcgcagaaactggtgctggtcagcacggt
gtggcaactgcaactgctgcggccctctttaacatggaatgtaccatctacatgggtgag
gaagatgtcaaacgccaagccctcaatgtcttccgtatggagcttttgggagctaaggtc
gaggccgtgacagatggttcgcgcgtgctcaaggatgcggtcaatgcagctcttcgttca
tgggtggctaatatagatgatacccactatatccttggttctgccttggggcctcatcca
tttccagaaatcgttcgtgacttccaaagtgtcatcggtcgagaggctaaacaacagtac
cgtgacttgacaggtcgagatctgccagatgccctagtagcctgtgttggtggtgggtcg
aatgctatcgggctcttccatccctttgtagaagatgagtcagtagctatgtatggaact
gaagcagcagggcttggtgtggatacagagcaccacgcagctaccttgaccaagggtcgt
ccaggtgtccttcacggttccctcatggatgtgctccaagatgcccatggtcaaattctt
gaagccttctctatctcagcaggtttggactatcctggtatcggtccagagcattctcac
taccacgatattaaacgtgccagctatgtccctgtgacagacgaagaagccttggaagga
ttccaactcttgtctcgtgtggaagggattatcccagccttggaatctagccatgctatc
gcctttgcggtgaaattggccaaagaacttggaccagaaaagtctatgattgtctgccta
tcaggtcgtggggacaaggatgtggttcaagtcaaggaccgcttggaagcagatgcagca
aagaagggagaagctcatgcctaa

DBGET integrated database retrieval system