KEGG   Sphaerotilus natans: EWH46_04310Help
Entry
EWH46_04310       CDS       T06182                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
snn  Sphaerotilus natans
Pathway
snn00450  Selenocompound metabolism
snn00970  Aminoacyl-tRNA biosynthesis
snn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EWH46_04310
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EWH46_04310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:snn01007]
    EWH46_04310
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:snn03016]
    EWH46_04310
Enzymes [BR:snn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EWH46_04310
Amino acid related enzymes [BR:snn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EWH46_04310
Transfer RNA biogenesis [BR:snn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EWH46_04310
 Prokaryotic type
   Other AARSs
    EWH46_04310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1f tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: QEN00077
UniProt: A0A5C1PXE0
Position
complement(903574..905643)
Genome map
AA seq 689 aa AA seqDB search
MTRQLFVTTALPYANGKFHIGHIMEYIQADIWVRFQRMRGHQVHFVGADDAHGAPIMIAA
EKAGKTPQQFVADIAAGRKEYLDGFHISFDNWHSTDGVENHELAQDIYRGLRDNGLIEVR
AIEQFFDPEKGMFLPDRFIKGECPKCGAKDQYGDSCESCGAVYSPTELKNPYSALSGATP
VLKTSDHYFFRLSDPRCVEFLQNWTTEPGKLQPEVLNKIKEWFTKDEEGQGGLGDWDISR
DAPYFGIEIPDAPGKFFYVWLDAPIGYLASLKNWFDKGGPAAKYGDTRSFAEFMASPDIE
QYHFIGKDITYFHTLFWPATLHFSGRRTPTNVFVHGFMTVNNGEKMSKSRGTGLDPLKYL
SLGMNAEWLRYYIAAKLNSHVEDVDFNRDDFTARVNADLIGKYVNIASRAAGFIAKRFGG
RLSADVGVEGRVLLDTLRAHRDTVTGLYEAREFGKVLREIMALADRVNEYVDQNKPWEIA
KQAGQDAVLQDVCTVCIEAFRLLTIYLKPVLPALAAQVEAFLQVEPLDFHATERALGAHA
IGSYQHLMQRVDPKLLEELFAAPEPEKVIPGGEDIAPEIKIDDFTKVDLRIARIVKAETV
DGSTKLLRLTLDAGEGRTRNVFSGIASAYKPEDLEGKLTVMVANLAPRKMKFGVSEGMVL
AASHADEKANPGVFVLEPFPGAQPGMRVR
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgacccgccagctcttcgtcaccaccgccctgccctacgccaacggcaagttccacatc
ggccacatcatggagtacatccaggccgacatctgggtgcggttccagcgcatgcggggc
caccaggtgcacttcgtcggcgccgacgacgcgcacggcgcgccgatcatgatcgccgcc
gagaaggccggcaagacgccgcagcagttcgtcgccgacatcgccgccggccgcaaggaa
tacctcgacggcttccacatctcgttcgacaactggcattcgaccgacggcgtcgagaac
cacgagctggcgcaggacatctaccgcggcctgcgcgacaacggcctgatcgaggtccgc
gcgatcgagcagttcttcgaccccgagaagggcatgttcctgcccgaccgcttcatcaag
ggcgagtgcccgaagtgcggcgcgaaggaccagtacggcgactcctgcgagtcctgcggc
gcggtctacagcccgaccgagctgaagaacccgtactcggcgctgtcgggcgccacgccg
gtgctcaagaccagcgaccactacttcttcaggctgtcggacccgcgctgcgtcgaattc
ctgcagaactggaccaccgagccgggcaagctccagcccgaggtgctcaacaagatcaag
gaatggttcaccaaggatgaagagggccagggcggcctgggcgactgggacatcagccgc
gacgcaccctacttcggcatcgagatcccggacgcgccgggcaagttcttctatgtctgg
ctggacgcgccgatcggctacctggcctcgctgaagaactggttcgacaagggcggcccg
gccgcgaagtacggcgacacccgcagcttcgccgaattcatggcctcgcccgacatcgag
cagtaccacttcatcggcaaggacatcacctacttccacacgctgttctggcccgcgacg
ctgcacttcagcggccgcaggacgccgaccaacgtcttcgtgcacggcttcatgaccgtc
aacaacggcgagaagatgagcaagagccgcggcaccgggctcgatccgctgaagtacctg
tcgctgggcatgaacgccgagtggctgcgctactacatcgccgccaagctcaactcgcat
gtcgaggacgtcgacttcaaccgcgacgacttcaccgcccgcgtcaatgccgacctgatc
ggcaagtacgtcaacatcgcctcgcgcgcggccggcttcatcgccaagcgcttcggcggc
cggctcagcgccgatgtcggcgtcgagggccgcgtgctgctcgacacgctgcgcgcgcac
cgcgacacggtgaccggcctgtacgaggcgcgcgagttcggcaaggtgctgcgcgagatc
atggcgctggccgatcgcgtcaacgagtacgtcgaccagaacaagccctgggagatcgcc
aagcaggccggccaggatgcggtgctgcaggacgtctgcaccgtctgcatcgaggccttc
cgcctgctgaccatctacctgaagccggtgctgccggcgctggccgcgcaggtcgaggcc
ttcctgcaggtcgagccgctggacttccacgccaccgagcgcgcgctgggcgcacatgcc
atcggcagctatcagcacctgatgcagcgcgtcgatccgaagctgctcgaagagctcttc
gccgcgcccgagcccgagaaggtcattcccggcggcgaggacatcgcgcccgagatcaag
atcgacgacttcaccaaggtcgatctgcgcatcgccaggatcgtcaaggccgagacggtg
gacggctcgaccaagctgctgcgcctgacgctcgacgccggcgagggtcgcacgcgcaac
gtcttcagcggcatcgccagcgcctacaagccggaagacctggaaggcaagctgaccgtg
atggtggccaatctcgcgccgcgcaagatgaagttcggcgtcagcgaaggcatggtgctg
gccgccagccatgccgacgagaaggcgaaccccggcgtcttcgtgctggagcccttcccc
ggcgcgcagccgggcatgcgcgtgcgctga

DBGET integrated database retrieval system