KEGG   Starkeya novella: Snov_0123Help
Entry
Snov_0123         CDS       T01258                                 

Definition
(GenBank) ABC transporter related protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
sno  Starkeya novella
Pathway
sno02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Snov_0123
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sno02000]
    Snov_0123
Enzymes [BR:sno01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     Snov_0123
Transporters [BR:sno02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    Snov_0123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 SbcCD_C RsgA_GTPase AAA_23 AAA_30 AAA_24 AAA_22 AAA_16 MMR_HSR1 AAA_27 PHAT
Motif
Other DBs
NCBI-ProteinID: ADH87460
UniProt: D7A0V0
Position
complement(119172..120704)
Genome map
AA seq 510 aa AA seqDB search
MHPTDGSLLELTGFSKSFTGLMALDKVDFTLRRGEIHALLGENGAGKSTLIKTMTGVVTR
DAGTMRLEGAEIAPRSAGEATKLGIATVYQEVNLAPNLSVAQNLFLGRQPTRLGFVREGE
MRRRAQALLAEFGLSIDVAAPLETYSVAIRHIVAIARAVDQSARVLILDEPTASLDAHEV
EVLFTVMRQLKARGIGIVFVTHFLDQVYAICDRITVLRNGRLAGTAPIAELPRIDLVRMM
LGRELSAATAQRPPRTAAAEAEPVAAFEDFGKAGYVAPFDLTLRAGHVVGLAGLLGSGRT
ETVRLVFGAERADSGTAEVGGARVVLSSPHEAMRLGFGYCPEERKTEGIVADLTVRENIV
LALQAKRGPLKPLPRREQDDIAAKFIRLLDIRPPDPERPVGLLSGGNQQKVLLARWLATA
PRLLILDEPTRGIDVGAHAEIIGLIRDLCAEGMALLVVSSELEEIVTYADEVVVLRDRAH
VARLTGDEVDVPAILAAIAADAPASVAAPM
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgaccgacggctccctgctcgaactcaccggcttctcgaaatccttcaccggc
ctcatggcgctggacaaggtcgacttcaccctgcgccgcggcgagatccatgcgctgctc
ggcgagaacggcgcgggcaagtcgacgctgatcaagacgatgaccggcgtcgtcacccgc
gatgccggcaccatgcggctggaaggcgccgagatcgcgccgcgctccgccggcgaggcg
accaagctcggcatcgccaccgtctaccaggaggtcaatctcgcgccgaacctatcggtg
gcgcagaacctgttccttggccgccagccgacccgtctcggctttgtccgcgagggcgag
atgcgccggcgcgcgcaggccctgctcgccgagttcggcctgtccatcgacgtcgccgcg
ccgctggagacctattcggtcgccatccggcacatcgtcgccatcgcccgcgcggtcgac
cagtcggcgcgcgtgctgatcctcgacgagcccaccgccagcctcgacgcgcacgaggtc
gaggtgctgttcaccgtgatgcgccagctcaaggcccgcggcatcggcatcgtcttcgtc
acccatttcctcgaccaggtctatgcgatctgcgaccggatcaccgtgttgcgcaatggc
cgcctcgccggcaccgccccgatcgccgagctgccgcgcatcgacctcgtgcggatgatg
ctcgggcgcgaactgagcgccgccaccgcccagcgcccgccgcgcaccgcggcggccgag
gcggaacccgtcgccgccttcgaagacttcggcaaggccggctatgtcgcccccttcgac
ctgacgttgcgcgccggccatgtggtcggcctcgccggcctgctcggctcgggccgcacc
gagaccgtccgcctcgtcttcggcgccgagcgcgccgacagcggcaccgccgaggtgggc
ggcgcgcgcgtcgtcctctcctcgccgcacgaggcgatgcgtctcggcttcggctattgc
ccggaggagcgcaagaccgagggcatcgtcgccgacctcaccgtgcgcgagaacatcgtg
ctggcgctgcaggcaaagcgcggcccgctgaagccgctgccgcgccgcgagcaggacgac
atcgcggccaagttcatccgcctgctcgacatccgcccgcccgacccggagcgccctgtc
gggctgctctccggcggcaaccagcagaaggtgctgctcgcccgctggctcgccaccgcg
ccgcgcctgctcatcctcgacgagccgacgcgcggcatcgatgtcggcgcccatgccgag
atcatcggcctgatccgcgacctctgcgccgagggcatggccctgctcgtcgtctcctcc
gagcttgaggagatcgtcacctatgccgacgaggtcgtggtgttgcgcgaccgcgcccat
gtcgcccgtctcaccggggacgaggtcgacgtgcccgccatactcgccgccatcgccgcc
gatgcgcccgcatcggtcgcggcgccgatgtga

DBGET integrated database retrieval system