KEGG   Starkeya novella: Snov_0815Help
Entry
Snov_0815         CDS       T01258                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sno  Starkeya novella
Pathway
sno00630  Glyoxylate and dicarboxylate metabolism
sno01100  Metabolic pathways
sno01110  Biosynthesis of secondary metabolites
sno01120  Microbial metabolism in diverse environments
sno01200  Carbon metabolism
Module
sno_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Snov_0815
Enzymes [BR:sno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Snov_0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADH88140
UniProt: D7A5L6
Position
complement(841919..843217)
Genome map
AA seq 432 aa AA seqDB search
MLDTLRTSTPDSFPAPAWAPDRWSGIRRSYGPADVRRLSGSLRIEHTLAQNGARRLWELL
QTQDFVPTLGTYTGAQAIQQVKAGLEAIYLSGWQVAADANSAGDMYPDQSLYPVDSVPAV
VKRINKALMRADQIQTMEKADGVTGPELDYFVPIIADAEAGFGGQLNAYELTKALIDAGA
AAVHFEDQLASEKKCGHLGGKVLVPTRQFIRTLNAARLAADVAGVPTVIMARTDAESARL
ITSDIDETDRPFITGERTAEGFYRYNGGFEAGIARAVAYAPYADLLWCETSTPSLDDARR
FAEGVHKAHPGKMLAYNCSPSFNWAKHMDKAQMKIFQRELGAMGYRYQFITLAGFHNLNY
TTFDLARRYREDGMAAYSQLQEAEFAAESRGFTGTRHQREVGTSYFDAIATVLSEGTSAT
TAMKESTETAQF
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgctggacacgcttcgcacctccacccccgacagcttccctgctccggcctgggcgccg
gaccgctggagcggcatccgccgcagctacgggcccgctgacgtccggcgcctctctggc
tcgctgcgcatcgagcacacgctcgcccagaacggcgcccgccgcctgtgggaactgctg
cagacgcaggacttcgtgccgacgctcggcacctacaccggcgcgcaggcgatccagcag
gtgaaggcggggctggaggcgatctacctctccggctggcaggtcgcggccgatgccaac
tcggcgggcgacatgtatcccgaccagagcctctacccggtcgacagcgtcccggcggtg
gtcaagcgcatcaacaaggcgctgatgcgcgccgaccagatccagaccatggagaaggcg
gacggcgtcaccggcccggaactcgactatttcgtgccgatcatcgccgatgccgaggcc
ggcttcggcggccagctcaacgcctatgagctgaccaaggcgctgatcgacgccggagcg
gcggcggtccatttcgaggaccagctggcgtcggagaagaagtgcggccatctcggcggc
aaggttctggtgccgacgcgccagttcatccgcacgctcaacgccgcgcgcctcgccgcg
gatgtggccggcgtgccgaccgtcatcatggcgcgcaccgatgcggaatcggcccggctc
atcacctcggacatcgatgagacggaccggcccttcatcaccggcgagcgcacggccgaa
ggcttctatcgctacaatggcggcttcgaagccggcatcgcccgcgccgtcgcctatgcg
ccctatgccgaccttctgtggtgcgagacctcgaccccgagcctcgacgatgcccgccgc
ttcgccgaaggcgtccacaaggcgcatccgggcaagatgctggcctataactgctcgccg
tccttcaactgggccaagcatatggacaaggcgcagatgaagatcttccagcgcgagctg
ggggcgatgggctaccgttaccagttcatcacgctggccggcttccacaacctcaactac
acgaccttcgacctcgcccgccgctaccgcgaagacggcatggccgcctattcgcagctg
caggaggcggagttcgcggcggaaagccggggcttcaccggcacccgccaccagcgcgag
gtcggcacctcctatttcgacgccatcgccaccgtgctcagcgaaggcaccagcgcgacg
acggcgatgaaggaatcgaccgagaccgcacagttctga

DBGET integrated database retrieval system