KEGG   Starkeya novella: Snov_1127Help
Entry
Snov_1127         CDS       T01258                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
sno  Starkeya novella
Pathway
sno00220  Arginine biosynthesis
sno00330  Arginine and proline metabolism
sno01100  Metabolic pathways
sno01110  Biosynthesis of secondary metabolites
sno01130  Biosynthesis of antibiotics
sno01230  Biosynthesis of amino acids
Module
sno_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Snov_1127
   00330 Arginine and proline metabolism
    Snov_1127
Enzymes [BR:sno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Snov_1127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADH88447
UniProt: D7A7J9
Position
1166918..1167835
Genome map
AA seq 305 aa AA seqDB search
MHCRILGAPVQDGAGRKGCEMGPSALRVAGLVEALRELGHTVDDLGRLASTPVPASHPNP
RLKSLPEIAGWTAALAEAAYRASDAAMPIFLGGDHSISAGTLAGVARRAAESRRPLFVLW
LDAHTDFHTLDSSTSGNLHGVPLAYATGQPGFEGCFPPLAARVEPTRVCAFGVRSIDPAE
RIAVDEAGVTLHDMRAIDEHGIAPLLRDFLGRVSAEEGLLHVSLDVDFLDPSIAPAVGTT
VPGGATFREAHLVMEMLHDSGRVASLDLVELNPFLDERGRTATLMVDLVASLMGRRIMDR
PTRSY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcactgcaggattttaggggcgcccgttcaggacggcgccgggcgcaagggatgcgag
atgggcccgagcgcgctgcgcgtcgccggactggtggaggcgttgcgcgaactcggtcac
accgtggacgatctcggcaggctggcgtcgacgcccgtacccgcctctcatcccaatccc
cgcctgaaatccctgccggagatcgcgggatggacggccgcgctcgccgaggccgcctat
cgcgcgagcgacgccgcgatgccgatcttcctcggcggcgatcacagcatctccgccggt
acgctggccggcgtggcgcggcgtgcggcggaatcccggcggccgctcttcgtgctctgg
ctggatgcgcacaccgatttccatacgctcgatagttcgacgagcggcaatctgcacggt
gtgccgctcgcctatgccaccggccagccgggcttcgagggctgtttcccgccgctcgcc
gcccgggtggagccgacccgcgtctgcgccttcggggttcgcagcatcgatccggcggaa
cgcatcgcagtcgatgaggcgggcgtgaccctgcacgacatgcgcgccatagacgagcac
ggcatcgccccgctgctgcgcgatttcctcgggcgggtgagcgcggaggagggcctgctg
cacgtcagcctcgacgtcgattttctcgacccttccatcgcccccgccgtcggcaccacc
gtccccggcggcgcgacgttccgcgaagcgcacctcgtcatggagatgctgcacgacagc
ggtcgcgtcgccagcctcgacctggtcgagctcaatccctttctcgacgagcgcgggcgt
accgcaaccctgatggtcgacctcgtcgcgagcctcatgggccgccgcatcatggaccgg
cccacgcggagctattga

DBGET integrated database retrieval system