KEGG   Starkeya novella: Snov_1669Help
Entry
Snov_1669         CDS       T01258                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sno  Starkeya novella
Pathway
sno00010  Glycolysis / Gluconeogenesis
sno00053  Ascorbate and aldarate metabolism
sno00071  Fatty acid degradation
sno00280  Valine, leucine and isoleucine degradation
sno00310  Lysine degradation
sno00330  Arginine and proline metabolism
sno00340  Histidine metabolism
sno00380  Tryptophan metabolism
sno00410  beta-Alanine metabolism
sno00561  Glycerolipid metabolism
sno00620  Pyruvate metabolism
sno00625  Chloroalkane and chloroalkene degradation
sno00903  Limonene and pinene degradation
sno01100  Metabolic pathways
sno01110  Biosynthesis of secondary metabolites
sno01120  Microbial metabolism in diverse environments
sno01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snov_1669
   00053 Ascorbate and aldarate metabolism
    Snov_1669
   00620 Pyruvate metabolism
    Snov_1669
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Snov_1669
   00561 Glycerolipid metabolism
    Snov_1669
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Snov_1669
   00310 Lysine degradation
    Snov_1669
   00330 Arginine and proline metabolism
    Snov_1669
   00340 Histidine metabolism
    Snov_1669
   00380 Tryptophan metabolism
    Snov_1669
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Snov_1669
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Snov_1669
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Snov_1669
Enzymes [BR:sno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Snov_1669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADH88974
UniProt: D7AAH1
Position
1726760..1728304
Genome map
AA seq 514 aa AA seqDB search
MATKETRGALRPVAEEVTQLLRALGVPDSSWRSGTRPVRSPITGEEVARIAEAGADDVAH
AVERSVAAFEAWRNVPAPRRGELVRLLGEELRAHKTELGRLVTLEAGKIVSEGLGEVQEM
IDICDFAVGLSRQLYGLTIASERPGHRMMETWHPVGPVGIISAFNFPVAVWSWNAALALV
CGNSLLWKPSEKTPLTALAVQALFERAAVAFGGAPEGLSQVLIGGAEVGAALTDDSRVPV
VSATGSTRMGRIVSERVARRFGRSILELGGNNAAIVCPSADLDLALRGIAFAAMGTAGQR
CTTLRRLIVNEGVYDTLLPRLAKAYGSVGIGDPREAGTLIGPLIDQAAFDAMQKALETAK
RAGARVHGGERVHAKEWPDAYYVRPALVELDEQIDLVKHETFAPILYVLRCSGLPEAIKL
HNAVPQGLSSSIFTNDMREAETFMSAEGSDCGIANVNIGPSGAEIGGAFGGEKETGGGRE
SGSDAWKAYMRRATNTINYSRQLPLAQGVSFDID
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaaagagacgcgcggggcgctgaggccggtcgcggaagaggtcacgcagctc
ctgcgcgccctcggcgtgccggattcgagctggcgcagcggcacccgcccggtgcgctcg
ccgatcaccggcgaggaggtcgcgcgcatcgccgaggccggcgccgacgatgtcgcccac
gcggtcgagcgttccgtcgccgccttcgaggcctggcgcaatgtgccggcgccgcggcgc
ggcgaactggtgcgcctgctcggtgaggagttgcgcgcccacaagaccgagctcggccgg
ctggtcacgctggaagccggcaagatcgtctccgagggcctcggcgaggtgcaggagatg
atcgacatctgcgacttcgccgtcggcctgtcgcgccagctctacggcctcaccatcgcc
tccgagcgtcccggccaccggatgatggagacctggcacccggtggggccggtcggcatc
atcagcgccttcaacttccccgtcgccgtgtggtcgtggaacgcggcgctggcgctggtc
tgcggcaacagcctgctgtggaagccctccgagaagaccccgctcaccgcgcttgccgtg
caggcgctgttcgagcgcgcggcggtcgccttcggcggcgccccggaaggcctgtcgcag
gtgctgatcggcggcgccgaagtcggcgcggcgctgaccgacgattcccgcgtgccggtc
gtctcggcgaccggctcgacccgcatgggccgcatcgtgagcgagcgggtggcacgccgc
ttcggccgctccatcctcgagctcggcggcaacaacgccgccatcgtctgcccctcggcc
gatctcgacctcgcgctgcggggcatcgccttcgccgccatgggcacggccggccagcgc
tgcaccacgctgcgccgcctcatcgtcaacgagggcgtctacgacacactgctgccgcgc
ctcgccaaggcctatggctcggtcggcatcggcgacccgcgcgaggccggcacgctgatc
ggcccgctgatcgatcaggcggcgtttgatgccatgcagaaggcgctggagaccgcgaag
agggccggcgcccgcgtgcatggcggcgagcgcgtccacgccaaggaatggccggacgcc
tattatgtccgcccggcgctggtcgagctcgacgagcagatcgacctcgtgaagcacgag
accttcgcgccgatcctctacgtcctgcgctgttccggcctgccggaggcgatcaagctg
cacaacgccgtgccgcagggcctctcgtcctcgatcttcaccaacgacatgcgcgaggcg
gagaccttcatgtcggcggaaggctcggattgcggcatcgccaatgtgaatatcggcccg
tccggtgcggagatcggcggcgcgttcggcggcgagaaggagaccggcggcgggcgcgag
tccggctcggacgcctggaaggcctatatgcggcgcgccaccaacaccatcaactattcg
cgccagctgccgctggctcagggcgtgtccttcgacatcgactga

DBGET integrated database retrieval system