KEGG   Starkeya novella: Snov_1812Help
Entry
Snov_1812         CDS       T01258                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sno  Starkeya novella
Pathway
sno00010  Glycolysis / Gluconeogenesis
sno00051  Fructose and mannose metabolism
sno00562  Inositol phosphate metabolism
sno00710  Carbon fixation in photosynthetic organisms
sno01100  Metabolic pathways
sno01110  Biosynthesis of secondary metabolites
sno01120  Microbial metabolism in diverse environments
sno01130  Biosynthesis of antibiotics
sno01200  Carbon metabolism
sno01230  Biosynthesis of amino acids
Module
sno_M00002  Glycolysis, core module involving three-carbon compounds
sno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snov_1812
   00051 Fructose and mannose metabolism
    Snov_1812
   00562 Inositol phosphate metabolism
    Snov_1812
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Snov_1812
Enzymes [BR:sno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Snov_1812
Exosome [BR:sno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Snov_1812
  Exosomal proteins of bladder cancer cells
   Snov_1812
  Exosomal proteins of melanoma cells
   Snov_1812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADH89116
UniProt: D6ZYK4
Position
complement(1892726..1893481)
Genome map
AA seq 251 aa AA seqDB search
MSKRRPLVAGNWKMHGLKASVAEFGRIAAGYDAALKAKVDLLVCPPATLMSTLAVAALGT
RIGIGGQDCHAKESGAYTGDIAAEMIADTGAVAVILGHSERRADHNETDAMARAKVLAAW
RASLTAILCVGETHAERDAFRALDVVRSQLSGSLPDGATAANTVIAYEPVWAIGTGRTPT
LGDIEEMHGVIRAELRVRFGDDADDMRLLYGGSVKPENAAEILAVADVDGALVGGASLKA
DTFLAIARAYL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcgtcgtccgctggtagcgggaaactggaagatgcacggcctcaaggcctcg
gtggcggagttcggccgcatcgccgcaggttatgatgccgcgctgaaggccaaggtcgac
cttctcgtctgtccgccggcgacgctgatgtcgacgctcgccgtcgccgcgctcggcacg
cggatcggcataggcgggcaggactgccacgccaaggaaagcggcgcgtataccggcgac
atcgctgccgagatgatcgccgacaccggcgccgtcgccgtcattctcggccattccgag
cgccgcgccgaccacaacgagaccgacgccatggcgcgcgccaaggtgcttgccgcctgg
cgcgccagcctcaccgccatcctctgcgtaggcgaaacccatgccgaacgcgacgccttc
cgggcactcgacgtggtgcgcagccagctctccggctcgctgcccgacggcgccacggcg
gcgaacaccgtcatcgcctatgagccggtctgggccatcggcaccggccggacgccgacc
ctcggcgacatcgaggagatgcacggcgtgatccgcgccgagctgcgcgtgcgcttcggc
gacgacgccgacgacatgcgcctgctctatggcggctcggtcaaaccggagaatgcggcg
gagattctcgccgtcgccgacgtcgatggcgcgctggtcggcggtgcgagtctgaaggcc
gacacttttctcgccatcgcgcgcgcctatctatag

DBGET integrated database retrieval system