KEGG   Starkeya novella: Snov_2033Help
Entry
Snov_2033         CDS       T01258                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
sno  Starkeya novella
Pathway
sno00250  Alanine, aspartate and glutamate metabolism
sno00330  Arginine and proline metabolism
sno01100  Metabolic pathways
sno01110  Biosynthesis of secondary metabolites
sno01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Snov_2033
   00330 Arginine and proline metabolism
    Snov_2033
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sno03000]
    Snov_2033
Enzymes [BR:sno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     Snov_2033
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     Snov_2033
Transcription factors [BR:sno03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    Snov_2033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH RHH_1
Motif
Other DBs
NCBI-ProteinID: ADH89331
UniProt: D7A070
Position
2134721..2138551
Genome map
AA seq 1276 aa AA seqDB search
MSTTTIGVKIDEELRARLKAAAEREGRSPHALVKQALIAAVERTERGMPAVAADTAAMLA
ADAGSAPQESPFLPFARSIQPQSVLRARITSAYRMPETEAVPMLIGPASLPEAKAEAAKE
RARSLVESLRAKGQKGPVEGLIHEYSLSSQEGVALMCLAEALLRIPDRATRDALIRDKIG
HGDWHAHVGQSPSLFVNAATWGLVLTGKLTTTSSEAGLSGALTRLIGRGGEPLIRKGVDV
AMRMMGEQFVTGQTISEALANSRRMEAKGFRYSFDMLGEAATTEADARRYLADYEQAIHA
IGKASAGRGIYEGPGISIKLSALHPRYSRAQYSRVVNELLPRVVTLAKLARQYDIGLNID
AEEADRLEISLDLLESLCFDESLSGWNGIGFVVQAYQKRCPYVIDYLIDLARRSNHRIMV
RLVKGAYWDSEIKRAQVDGLEGFPVYTRKVHTDVAYLACARKLLAAPDAVFPQFATHNAQ
TLSAVMEMAGANYYAGQYEFQCLHGMGEPLYEEVVGREKLGRPCRIYAPVGTHETLLAYL
VRRLLENGANSSFVNRIADEAVPVDELIESPVAAASRIEPMGAPHPRIAAPDDLFGEERR
NSAGLDLSNEQRLASLAAALLAGSAVPLKAVPLLGDGPAEGVARPVLNPADHRDQVGTVE
EATPETVARAMEIAQGAAPIWQSTPPEERAQCLSRAADLMEARMPALIGIIVREAGKSFP
NAIGEVREAVDFLRYYGAQLKGWSGDTHRPLGPVVCISPWNFPLAIFTGQVAAALASGNA
VLAKPAEETPLIAHAAVEILREAGVPPGAVQLVPGGGEVGAALVGDARTRGVMFTGSTEV
ARLIQSQLAERLSPEGGVIPLIAETGGQNAMIVDSSALAEQVVADVLSSAFDSAGQRCSA
LRILCLQEDVADRMLEMLRGALKELSVGNPVQLSTDIGPVITAEARETIEAHIARMRKAG
RPVEQLELDAETRHGTFVPPTLIEIDDIAELHREVFGPVLHVVRYRRDDLDALIDAIDAT
GYGLTFGLHTRIDETIAHVGARIEAGNVYVNRNIIGAVVGVQPFGGHGLSGTGPKAGGPL
YLQRLLSVRPSIALPAAGAPEPARLWTDFVSDPATRALCGAVLDASPYGHKAELSGPVGE
RNVYVLKPRGTVLCLAATERGLAVQIASVLATGNRVLLEGTDLPALPAGLESHVGITDDL
ASARFDAVLFEGDSDALHRLNGEIAARGGPIVLVHGLHPDALARGELYPLDLLMLEGATS
INTAAAGGNASLMSIG
NT seq 3831 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaccaccatcggcgtgaagatcgacgaggagctccgcgcccggctgaaggcc
gccgccgagcgcgagggccgctcgccgcacgcgctggtcaagcaggcgctcatcgctgcc
gtcgaacgcaccgagcgcggcatgccggccgtggccgccgatacggcggcgatgcttgcc
gccgatgccggcagcgccccgcaggagagccccttcctgcccttcgcccgctccatccag
ccgcaaagcgtgctgcgcgcccgcatcacctcggcctaccgcatgccggagaccgaggcg
gtgcccatgctcatcggcccggccagcttgcccgaagccaaggcggaggccgcgaaggag
cgcgcccgttccctcgtggaatcgttgcgcgccaagggccagaagggcccggtcgagggc
ctgatccacgaatattcgctgtccagccaggaaggtgtggcgctgatgtgcctcgccgag
gcgctgctgcgcatccccgaccgcgccacccgcgacgcgctgatccgcgacaagatcggc
catggcgactggcacgcccatgtcggccagagcccctcgctcttcgtcaacgccgccacc
tggggcctggtgctcaccggcaagctgaccacgacctccagcgaggcgggcctgtcgggc
gccctcacccgcctcatcggccgcggcggcgaacccctgatccgcaagggcgtcgacgtc
gccatgcggatgatgggcgagcagttcgtcaccggccagaccatctccgaggcgctggcg
aactcgcgccgcatggaggcgaagggcttccgctattccttcgacatgctgggcgaggcc
gccaccaccgaggccgatgcgcgccgctacctcgccgattacgagcaggcgatccacgcc
atcggcaaggcctcggccgggcgcggcatctatgaggggccgggcatctcgatcaagctc
tcggccctgcacccgcgctacagccgcgcgcaatattcccgtgtcgtcaatgagttgctg
ccgcgtgttgtcacgctggcgaagctcgcgcggcagtacgacatcggcctcaacatcgac
gccgaggaagccgaccggcttgagatctcgctggacctgcttgaatcactttgcttcgac
gagtcgctaagcggctggaacggcatcggtttcgtcgtccaggcctaccagaagcgctgc
ccctatgtgatcgactacctgatcgacctcgcgcgccgctcgaaccaccgcatcatggtg
cggctggtgaagggcgcgtactgggacagcgagatcaagcgcgcgcaggtggacgggctg
gaaggcttcccggtctatacccgcaaggtccacaccgacgtcgcctatctcgcctgcgcc
cgcaagctgctcgcggcgcccgacgccgtgttcccgcaattcgccacccacaacgcgcag
acgctctccgccgtcatggagatggccggcgccaactactatgccggccagtacgagttc
cagtgcctgcacggcatgggcgagccgctctatgaggaggtcgtcggccgcgagaagctc
ggccgcccctgccgcatctacgcccccgtcggcacccacgagacgctgctcgcctatctc
gtgcggcgcctgctcgaaaacggtgccaattcctccttcgtcaaccgcatcgccgacgag
gcggtgccggtggacgagctgatcgagagcccggtcgccgcggcctcgcgcatcgagccg
atgggcgcgccgcatccgcgcatcgctgcgccggacgacctgttcggcgaggagcgccgc
aactcggccggcctcgacctttccaacgagcagcgcctcgcctcgctcgccgccgccctg
ctcgccggcagcgccgtgccgctgaaagccgtgccgctgctcggcgacggcccggccgag
ggcgtcgcccgcccggtgctcaacccggccgaccatcgcgaccaggtcggcacggtggag
gaagcgacgcccgagaccgtcgcccgcgccatggagatcgcccagggcgcggcgccgatc
tggcaatcgacgccgccggaggagcgcgcccagtgcctttcccgcgccgccgatctgatg
gaggcgcgcatgccggcgctcatcggcatcatcgtgcgcgaggccggaaaatccttcccc
aacgccatcggcgaggtgcgtgaagccgttgatttcctgcgctattacggcgcgcaactg
aagggctggtccggcgatacgcatcgcccactcggcccggtggtgtgcatcagcccgtgg
aacttcccgctcgccatcttcaccggccaggtcgccgccgcgctcgcctccggcaatgcg
gtgctggccaagccggccgaggagacgcccctcatcgcccatgcggcggtcgagatcctg
cgcgaggccggcgtgccgcccggcgcggtgcagctcgtgcccggcggcggcgaggtcggc
gcggctctggtcggcgatgcccgcacacgcggcgtcatgttcaccggctcgaccgaggtg
gcgcggctcatccagagccagctcgccgaacgcctgagcccggaaggcggcgtcatcccg
ctcatcgccgagaccggcgggcagaacgccatgatcgtcgattcctcggcgctggccgag
caggtggtggcggacgtgctgtcctccgccttcgattccgccggccagcgctgctcggcg
ctccgcatcctgtgcctgcaggaggacgtggccgaccgcatgctggagatgctgcgcggc
gcgctgaaggagctttccgtcggtaatcccgtgcagctctccaccgatatcggcccggtc
atcactgccgaggcgcgcgagaccatcgaggcgcacatcgcccgcatgcgcaaggcgggc
cgccccgtcgagcagctggagctcgatgcggagacgcgccacggtaccttcgtgccgccg
accctcatcgagatcgacgacatcgccgaactgcaccgcgaggtgttcggcccggtgctg
catgtggtgcgctatcgccgcgacgacctcgacgcgctgatcgacgccatcgacgccacc
ggctacggcctcaccttcggcctgcacacccgcatcgacgagaccatcgcccatgtcggc
gcgcgcatcgaggcaggcaatgtctatgtgaaccgcaacatcatcggcgccgtagtgggc
gtgcagcccttcggcggtcacggcctctccggcaccgggccgaaggccggcgggccgctc
tatctgcaacgcctgctgagcgtgcgtccgtccatcgccctgcccgccgccggcgcgccg
gagccggcgcggctctggaccgacttcgtctccgatcccgccacccgcgcgctgtgcggc
gccgtgctcgacgcctcgccctatggccacaaggcggaactttccggcccggtcggcgag
cgcaacgtctatgtgctcaagccccgcggcacggtactgtgccttgccgcgacggagcgg
gggctggcggtgcagatcgcctcggtgctcgccaccggcaaccgcgtgctgctggagggc
accgacctccccgctttgcccgccgggctggagagccatgtcggcataaccgacgacctc
gcgagcgcgcggttcgatgcggtgctgttcgagggcgacagcgatgccctgcaccggctg
aacggcgagatcgccgcccgcggcgggccgatcgtgctcgtgcacgggctgcatcccgac
gcgctcgcgcgcggcgagttgtacccgctcgacctcctgatgctcgaaggtgcaacctcc
atcaacaccgcggccgccggtggcaatgccagcctgatgagcatcggctga

DBGET integrated database retrieval system