KEGG   Starkeya novella: Snov_2457Help
Entry
Snov_2457         CDS       T01258                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
sno  Starkeya novella
Pathway
sno02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Snov_2457
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sno02022]
    Snov_2457
Two-component system [BR:sno02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Snov_2457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ADH89752
UniProt: D7A3J3
Position
2576858..2577604
Genome map
AA seq 248 aa AA seqDB search
MLDAKLDTKLSEDARIARPMPADDAFHLLIVDDDRRIRDLLSRFLTEHGYRVTTAESAAD
ARARLAGLTFDLLILDVMMPGESGFELARAVREGSGVPIMMLTARSETGDRIEGLEIGAD
DYLAKPFEPRELLLRIGNIIKRAVPPPAQAIETVRFGPFMFHLARGELTRDGELVRLTDR
ERDMLRVLGEKPGETVPRQALVAPGVAAGDRAVDVQVNRLRRKIERDPANPAYVQTVRGL
GYRLVVAP
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaagctcgacacgaagctgtccgaggatgcgaggatcgcccggcccatg
cctgccgacgacgccttccacctgctgatcgtcgatgacgaccggcgtatccgcgacctg
ctgtcccggttcctgacggagcacggctaccgcgtcaccacggcggaatccgccgccgac
gcccgcgcccggctggcggggctgaccttcgacctgctcatcctcgacgtgatgatgccc
ggcgagagcggcttcgagctcgcccgcgccgtgcgcgagggctcgggcgtgccgatcatg
atgctcaccgcccgttcggagaccggcgaccgcatcgaggggctggagatcggcgccgac
gactatctcgccaagccgttcgagccgcgcgaattgctgctgcgcatcggcaacatcatc
aagcgcgccgtgcccccgccggcgcaggcgatcgagaccgtgcgcttcgggccgttcatg
ttccatctggcccgcggcgagctgacccgcgacggcgaactggtccgcctcaccgaccgc
gagcgcgacatgctgcgcgtgctcggcgagaaaccgggcgagaccgtgccgcgccaggcg
ctcgtcgcccccggcgtcgccgccggcgaccgggcggtggacgtgcaggtcaaccgcctg
cgccgcaagatcgagcgcgatcccgccaacccggcctatgtccagaccgtgcggggcctc
ggctaccggctggtcgtcgccccttga

DBGET integrated database retrieval system