KEGG   Starkeya novella: Snov_2818Help
Entry
Snov_2818         CDS       T01258                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sno  Starkeya novella
Pathway
sno00010  Glycolysis / Gluconeogenesis
sno00052  Galactose metabolism
sno00500  Starch and sucrose metabolism
sno00520  Amino sugar and nucleotide sugar metabolism
sno00521  Streptomycin biosynthesis
sno01100  Metabolic pathways
sno01110  Biosynthesis of secondary metabolites
sno01120  Microbial metabolism in diverse environments
sno01130  Biosynthesis of antibiotics
sno01200  Carbon metabolism
Module
sno_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snov_2818
   00052 Galactose metabolism
    Snov_2818
   00500 Starch and sucrose metabolism
    Snov_2818
   00520 Amino sugar and nucleotide sugar metabolism
    Snov_2818
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Snov_2818
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Snov_2818
Enzymes [BR:sno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Snov_2818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ADH90106
UniProt: D7A5Z1
Position
2957420..2958391
Genome map
AA seq 323 aa AA seqDB search
MPHLILIADIGGTSSRLAVVDTDGVPRDIQIHRNDDFAGFKELIAADLDQRGPGARTAVG
GAVLAVAGPADQESVKLTNRDWGFTKRDMRKHFGWQKFAAVNDFEALAHGVPALGASDLV
PVGGGLAEPGAPMLVCGPGTGFGVAGIVKIAGRHHAITGEGGRARLGAADAEEALLLGHL
VRELGPVVVEHALSGSGLARIHRILAGAALTPEAVIAAAKAGDEAARETCNVFLKLFGRI
AGDLALIVNARGGVYLAGGVSAGLAPFFAESPFRAMFEEHPPHGPRLVATPVNIITHPTP
GLIGCGQLGARLARSLKPGLHVV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgccccatctcatcctgatcgccgatatcggcggaacctcctcccgcctcgccgtcgtc
gacacggacggcgtgccgcgcgacatccagatccaccgcaatgacgacttcgccggcttc
aaggagctgatcgcggccgacctcgaccagcgcggccccggcgcacgcacggcggtcggc
ggcgccgtccttgccgtggccgggccagccgaccaggagagcgtgaagctcaccaaccgc
gactggggcttcaccaagcgcgacatgcgcaagcatttcggctggcagaaattcgccgcg
gtgaacgatttcgaggcgctcgcccatggcgtgccggcgctcggcgcttccgacctcgtg
ccggtcggcggcggccttgccgagccgggcgcgccgatgttggtctgcggccccggcacc
ggcttcggcgtcgccggcatcgtcaagatcgccggccgccaccacgccatcaccggcgaa
ggcggccgcgcccgcctcggcgccgcggatgccgaggaggcgctgctgctcggccatctg
gtgcgcgagctcggccccgtcgtggtggagcatgcgctgtcgggctcgggcctcgcccgc
atccaccgcatcctcgccggcgccgcgctgacacccgaggcggtgatcgccgccgccaag
gcgggtgacgaggccgcgcgcgagacctgcaacgtattcctgaagctgttcggccgcatc
gccggcgacctcgcgctcatcgtcaatgcgcgcggcggcgtctatctcgccggcggcgtc
tcggcggggctggcgccgttcttcgcggaatcgcccttccgcgccatgttcgaggagcac
ccgccgcacgggccgcgcctcgtcgccacgccggtcaacatcatcacccacccgacgccg
ggcctgatcggctgcggccaactcggcgcgcggctcgcccgcagcctcaagcccggcctg
cacgtcgtgtga

DBGET integrated database retrieval system