KEGG   Starkeya novella: Snov_2864Help
Entry
Snov_2864         CDS       T01258                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
sno  Starkeya novella
Pathway
sno00970  Aminoacyl-tRNA biosynthesis
sno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sno00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Snov_2864
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sno03029]
    Snov_2864
Enzymes [BR:sno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Snov_2864
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Snov_2864
Mitochondrial biogenesis [BR:sno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Snov_2864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ADH90149
UniProt: D7A6F1
Position
complement(3001615..3003057)
Genome map
AA seq 480 aa AA seqDB search
MSDLTRLSLRTLRRLMISGEVRPEDVVAAFLVRAEARNSRDLSYISIGAEEALACAGRVE
QAGTSGRLAGIPFSCKDVFDTVTLPTTAGSRAMQDYRPARDAQALARLRVSGAILLGKNN
LHEFCYGITGANPTFGTPANPHDRHRLAGGSSSGSAVAVTNRTAMFALGTDTGGSVRVPA
SLCGLVGFKPTRGQISLKGVVPFCWSLDHAGILTRSCGDAADVFLAVREAQQAVSGANAD
HSERGNSLHGLRIGVPRGAYLDNAASDIAASVHHLIAECRRLGAQIVDVVMPDDTHVRTA
SLAVQLVEAFAWHRTNLQRRFDLYGEDVREGLLQGQFILAEHYVQALRLIAVKQAEVSEL
LKDVDVLMTPTTPVVAPPLDQKQVTLAGVVVPIGNALSHFTCLFNLTGHPALTVPIGRNG
DGLPMGMQLIGKHYRDMKLLAIGAALERVGLAGWIEPNDEMDDSPGMPPPLAERRELYAH
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctcacgcgtctgtccctgcgcacgctccggcggcttatgatctccggggag
gtccggccggaagacgtggtcgcggcgtttctggtccgggccgaagcgcgcaatagtcgc
gatctcagctatatctcaatcggggcggaagaggctctggcgtgcgctggccgggtggaa
caggctggcacgtccgggcgcctcgccggcattcccttctcctgcaaggacgtgttcgac
acggtgaccctgccgaccacggccggctcgcgcgccatgcaggactatcggcccgcgcgg
gacgcgcaagccctggcgcgcctccgggtttctggcgccatactgctgggaaagaacaat
ctgcacgagttctgctacggcatcaccggcgccaatccgaccttcggcacgccggccaac
ccgcatgaccggcatcgcctggcgggcgggtcctccagcggctccgccgttgcggtcacc
aaccgcacggcgatgttcgccctcggcaccgataccggtggctcagtgcgcgttcctgcg
agcctctgtggccttgtcggcttcaagccgacgcgcgggcagatcagtctaaagggcgtg
gtgccgttctgctggtcgttggatcacgccgggattctcacgcgaagctgcggggacgca
gccgacgtgttcctggccgttcgcgaggcgcagcaggctgtctcgggagcgaacgctgat
cattccgagcgtggcaactcgctgcatggtctacgcatcggcgtacccagaggggcctat
cttgataatgcggcgtccgacattgctgcgagcgtgcatcacctcatcgcggaatgccgc
cggctcggggcccagatcgtcgatgtggtgatgccggacgacacccatgtgcgcacggca
tcgctggccgtccagctcgtcgaggcctttgcctggcaccggacaaatctccagcgccgg
ttcgatctgtatggcgaggatgtgcgcgaaggactgcttcagggccagtttatcctggcc
gagcattatgtgcaggcgctccgcctcatcgctgtcaaacaggcagaggtcagtgagttg
cttaaagacgttgatgtactcatgacgccgacgactcccgtcgttgcgccgcctctggat
cagaagcaggtcacgcttgcaggcgttgtggtcccgatcggcaatgcactctcccacttc
acctgcctgttcaacctgaccggtcatccggcgctcaccgttcccatcggccggaacggt
gacggcttgccgatggggatgcaactgattggaaagcactatcgggacatgaagcttctg
gcgatcggcgccgcgctggaacgggtcggtctggccggctggatcgagccgaacgatgag
atggacgacagccccggcatgccgcctccgctggcggaacggcgagagctctacgcgcac
tag

DBGET integrated database retrieval system