KEGG   Starkeya novella: Snov_2988Help
Entry
Snov_2988         CDS       T01258                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sno  Starkeya novella
Pathway
sno00020  Citrate cycle (TCA cycle)
sno00640  Propanoate metabolism
sno00660  C5-Branched dibasic acid metabolism
sno01100  Metabolic pathways
sno01110  Biosynthesis of secondary metabolites
sno01120  Microbial metabolism in diverse environments
sno01130  Biosynthesis of antibiotics
sno01200  Carbon metabolism
Module
sno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Snov_2988
   00640 Propanoate metabolism
    Snov_2988
   00660 C5-Branched dibasic acid metabolism
    Snov_2988
Enzymes [BR:sno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Snov_2988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ADH90264
UniProt: D7A6R6
Position
3122960..3124159
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQAKGVLREYGVPVPNGVAILDAAEADAAAAKIPGPVWVVKSQIHAGGRGKGKFK
EADAGEKGGVRVVKSAGEAAANAKQILGKTLVTVQTGPAGKQVNRVYIEEGSDIDKEFYL
SALVDRATSRVAFVVSTEGGMDIEEVAHSTPEKIHTFSIDPATGVMPHHGRTVAQALGLS
GDLAKQAGNLVTKLYAAFVGKDMAMLEVNPLVVTKGGELKCLDAKISFDSNSLYRHPDVV
ALRDETEEDAKEIEASKYDLAYIALDGTIGCMVNGAGLAMATLDIIKLYGESPANFLDVG
GGATEEKVTAAFKIITADPQVQGILVNIFGGIMKCDVIARGVIAAVKAVGLQVPLVVRLE
GTNVEEGKQIIRDSGLNVIPADDLDDAAQKIVKAVKEAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccatgagtatcaggccaagggagtgctccgcgaatacggggtcccggtgccg
aacggcgtcgccattctcgacgcggccgaggccgacgccgcggcggcgaagattcccggc
ccggtctgggtcgtgaagagccagatccacgccggcggacgcggcaagggcaagttcaag
gaagccgatgcgggcgagaagggtggcgtgcgcgtcgtcaagtccgccggcgaggctgcc
gccaatgccaagcagatcctcggcaagaccctggtgaccgtgcagaccggcccggccggc
aagcaggtgaaccgcgtctacatcgaggaaggctccgacatcgacaaggagttctacctc
tccgccctcgtcgaccgcgccacctcgcgcgtcgccttcgtcgtctcgaccgaaggcggc
atggacatcgaggaagtcgcccactcgacgcccgagaagatccacaccttctccatcgac
ccggcgaccggcgtgatgccccatcacggccgcaccgtcgcgcaggcgctcggcctgtcc
ggcgacctcgccaagcaggcgggcaacctcgtcaccaagctctatgccgccttcgtcggc
aaggacatggcgatgctcgaggtcaacccgctggtcgtcaccaagggtggcgagctgaag
tgccttgacgccaagatctccttcgattccaactcgctctaccgccacccggacgtggtc
gcgctgcgcgacgagaccgaggaggacgccaaggagatcgaggcgtccaagtacgacctc
gcctatatcgcgctcgatggtaccattggctgcatggtcaacggcgccggcctggccatg
gcgacgctcgacatcatcaagctctatggcgagagcccggccaacttcctcgacgtcggt
ggcggcgccacggaggagaaggtcactgcggcgttcaagatcatcaccgccgacccgcag
gtgcagggcatcctggtcaacatcttcggcggcatcatgaagtgcgacgtcatcgcccgc
ggcgtcatcgccgcggtgaaggcggtcggcctgcaggtgcccctcgtggtgcgcctcgaa
ggcaccaatgtcgaggaaggcaagcagatcatccgcgactcggggctgaacgtcatcccg
gcggacgatctcgacgacgccgcccagaagatcgtcaaggccgtgaaggaggctgcgtga

DBGET integrated database retrieval system