KEGG   Starkeya novella: Snov_2992Help
Entry
Snov_2992         CDS       T01258                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
sno  Starkeya novella
Pathway
sno00230  Purine metabolism
sno00250  Alanine, aspartate and glutamate metabolism
sno01100  Metabolic pathways
Module
sno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Snov_2992
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Snov_2992
Enzymes [BR:sno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     Snov_2992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ADH90268
UniProt: D7A6S0
Position
complement(3127162..3128457)
Genome map
AA seq 431 aa AA seqDB search
MANVVVVGSQWGDEGKGKIVDWLSEQADVVVRFQGGHNAGHTLVVGNTTYKLSLLPSGLV
RGARLSVIGNGVVLDPWALVDEIGRIGAQGVEVTPERLRVAENVALILPLHRELDAIREN
AAASGTKIGTTKRGIGPAYEDKVGRRAIRLMDLAYPDTLDAKLERLLAHHNPLRRGLGIA
EVDAARLRDELLEVAPKVLPFMDRVWALLDDERRHGSKILFEGAQGALLDVDHGTYPFVT
SSNTVAAQAATGSGLGPGAIGYVLGITKAYTTRVGEGPFPTELDDAIGRKIGERGHEFGT
VTGRARRCGWFDAALVRQTVRTSGINGIALTKLDVLDGFEELKVCTRYRLDGEEIDYLPA
GQDAQAHVEPVYETIEGWRTSTAGARSWADLPAEAVKYVRRIEELIGCPVALLSTSPERD
DTILVQNPFES
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaatgtggtcgtcgtcggctcgcaatggggcgacgagggtaagggcaagatcgtc
gattggctcagcgagcaggcggacgtcgtcgtccgcttccagggcgggcacaatgccggt
catacgctggtggtgggcaacaccacctacaagctttcgctgctgccgtccggcctggtg
cgcggcgcgcgcctgtcggtgatcggcaacggcgtggtgctcgacccgtgggcgctggtg
gacgagatcggccgcatcggcgcgcagggcgtcgaggtgacgccggagcgtctgcgcgtc
gccgagaacgtcgcgctgatcctgccgctgcaccgcgaactcgacgccatccgcgagaac
gccgccgcctccggcaccaagatcggcaccaccaagcgcggcatcggcccggcctatgag
gacaaggtcggccggcgtgccatccggctgatggacctcgcctatcccgacacgctcgac
gccaagctggagcgcctgctggcgcatcacaatccgctgcgccgcggcctcggcatcgcc
gaggtggacgcggccaggctgcgcgacgaactgctcgaagtggcgcccaaggtgctgccc
ttcatggatcgcgtctgggcgctgctcgacgacgagcgccggcacggctcgaagatcctg
ttcgagggcgcgcagggcgcgctgctcgacgtcgaccacggcacctatcccttcgtcacc
tcctccaacacggtggcggcgcaggcggcgaccggctccggcctcggccccggcgccatc
ggctatgtgctcggcatcaccaaggcctacaccacccgcgtcggcgaaggcccgttcccg
accgagctcgacgacgcgatcggccgcaagatcggcgagcgcgggcacgagttcggcacc
gttaccgggcgggcgcggcgctgcggctggttcgacgccgcactggtgcgccagaccgtg
cgcacctccggcatcaacggcatcgcgctgaccaagctcgacgtgctggacggcttcgag
gaactcaaggtctgcacccgctaccggctcgacggggaggagatcgactatctcccggcc
gggcaggatgcgcaggcgcatgtcgagccggtctacgagaccatcgagggctggaggaca
tcgaccgccggcgcccgttcttgggccgacctgccggcggaagcggtgaaatatgtccgt
cgtatcgaggaactgatcgggtgcccggtggcgttgctgtccacgagccccgagcgtgat
gatacgatcttggtgcagaatcccttcgaatcgtga

DBGET integrated database retrieval system