KEGG   Starkeya novella: Snov_3256Help
Entry
Snov_3256         CDS       T01258                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
sno  Starkeya novella
Pathway
sno00053  Ascorbate and aldarate metabolism
sno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Snov_3256
Enzymes [BR:sno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     Snov_3256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd NAD_binding_4 RmlD_sub_bind 3Beta_HSD NAD_binding_10 adh_short KR Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ADH90530
UniProt: D7A8J6
Position
complement(3421552..3422421)
Genome map
AA seq 289 aa AA seqDB search
MTEPVAAGPVLLTGASGTLGRLLAERLTREGRTLVLTDLIEPDYELPAGVRFMVADLADR
EAVLRLGNDYAAIVHFGAVSTERDFADIFGPNIAGAHHIFDLARASKARVIFASSNHAIG
FNRRDVRLDEDCDLRPDGYYGLSKAYGELLARLYWDKHGLESLSLRIGSCVERPTELRHL
STWLSFDDLVRLVEAGLTHPALGCRIAWGVSANSRAWWVSNDEIGTAARDDAERFAGAVV
AGAAEADPVSSRYQGGTFCASGYDREEFSPQELFGWRGTGQAMPSRTVE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacccgtcgcagccggccccgtgcttctcaccggcgcctccggcacgctcggc
cgactgcttgccgaacggctgacgcgcgaggggcggacgctggtcctgaccgacctcatc
gaacctgattacgagcttccggcgggcgtacgcttcatggtcgccgatctcgccgaccgc
gaggcggtactgcggctcggcaatgattacgccgccatcgtgcatttcggcgccgtctcg
accgagcgcgatttcgccgacatcttcgggccgaacatcgccggcgcacaccacatcttc
gacctcgcccgagcctccaaggcgcgggtgatattcgcttcctccaatcacgcgatcggc
ttcaatcgtcgcgacgtgaggctcgacgaggactgcgatctgcgccccgacggatattac
ggtctgagcaaggcctatggcgaattgctggcgcggctctactgggacaagcacgggctc
gagagcctgtccctgcgcatcggcagctgcgtggagcggccgacggagctgcggcatctg
tcgacctggctgagcttcgacgacctcgtgcgcctcgtcgaagccgggctgacgcatccg
gcgctcggctgccggatcgcctggggggtgtcggcgaacagccgcgcgtggtgggtgtcc
aatgacgagatcggcacagcggcgagggacgatgcggagcgatttgccggcgccgtcgtc
gccggggccgcggaagccgacccggtgtcgtcgcggtatcagggcggaacgttctgtgcg
tccggttatgaccgggaggagttctcgccgcaggaactgttcggctggcgcgggaccggg
caggcgatgccctcacgcacggtcgaatga

DBGET integrated database retrieval system