KEGG   Starkeya novella: Snov_3398Help
Entry
Snov_3398         CDS       T01258                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sno  Starkeya novella
Pathway
sno00030  Pentose phosphate pathway
sno00480  Glutathione metabolism
sno01100  Metabolic pathways
sno01110  Biosynthesis of secondary metabolites
sno01120  Microbial metabolism in diverse environments
sno01130  Biosynthesis of antibiotics
sno01200  Carbon metabolism
Module
sno_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sno_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
sno_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:sno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Snov_3398
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Snov_3398
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sno04147]
    Snov_3398
Enzymes [BR:sno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Snov_3398
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Snov_3398
Exosome [BR:sno04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Snov_3398
  Exosomal proteins of colorectal cancer cells
   Snov_3398
  Exosomal proteins of bladder cancer cells
   Snov_3398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ADH90672
UniProt: D7A9B0
Position
3576620..3578095
Genome map
AA seq 491 aa AA seqDB search
MTSRVIPVAPFTLTVFGATGDLSRRKLIPALFHRDLDGQIPDEATIIGVSRRPLSDDEFR
AFARQALNDHIPAAELQGPEVDRFLGRLSYVAADAGAEPGWSELASRVAAQADHVPVYYL
ATAPALFGPICEKLGKYGLAENGRVVIEKPIGKDLKSAIALNQQVGRIFPEDRVYRIDHY
LGKETVQNLMALRFANALFEPLWNNAHIDHVQITVAEALGVEERAGYYDTAGAMRDMVQN
HMLQLLCLVAMEPPSSLDADAVRDEKLKVLRALKPIDDHNMATVTVRGQYRAGASAGGAV
PGYLEELGSSRSQTETFVAVKAEVENWRWAGVPFYLRTGKRLASRVSEIVVNFRPVPHSV
FDDTAGPIDPNRLVIRLQPDEGVKLWLMIKDPGPGGIRLTHVPLDMSFAKAFKVRNPDAY
ERLILDVVRGNQTLFMRRDEVEAAWRWVDPILEAWRSAKEPPRPYTAGTWGPSAAIALIE
RDGRTWLEDGA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaccagccgcgtgattccggtagctcccttcacgctgaccgtcttcggcgcgaccggc
gacctctcccgccgcaagcttatccccgccctgttccatcgcgacctcgacggccagatc
ccggacgaggcgacgatcatcggcgtgtcgcgccgtccgctgagcgacgacgagttccgc
gccttcgcccggcaagcgctgaacgaccacatccccgccgccgagttgcaggggccggag
gtcgaccgcttcctcggccgcctctcctatgtcgccgccgatgccggcgccgagcccggc
tggtcggagcttgcaagccgcgtcgcggcgcaggccgaccacgtcccggtctattacctc
gccaccgcgccggcgcttttcgggccgatctgcgagaagctcggcaaatacggcctcgcc
gagaacggccgcgtcgtcatcgagaagccgatcggcaaggacctgaaatccgccatcgcg
ctcaaccagcaggtcgggcgtatcttccccgaggaccgcgtctaccgcatcgaccattac
ctgggtaaggagacggtgcagaacctgatggcgttgcgcttcgccaacgccctgttcgag
cctttgtggaacaacgcccatattgaccatgtgcagatcaccgtcgccgaggcgctcggt
gtcgaggagcgcgccggctattacgacaccgccggcgccatgcgcgacatggtgcagaac
cacatgctccagctcctctgcctcgtcgccatggagccgccttcctcgctcgacgccgac
gcggtgcgcgacgagaagcttaaagtgctgcgcgcgctcaagcccatcgacgaccacaac
atggcgaccgtcaccgtgcgcgggcagtaccgcgccggcgcctcggcgggcggcgcggtg
cccggctatctggaggagctcggctcctcgcgcagccagaccgagaccttcgtcgcggtg
aaggcggaggtggagaactggcgctgggccggcgtgccgttctacctgcgcaccggcaag
cggctcgcctcgcgcgtctcggagatcgtggtcaatttccgccccgtgccgcattcggtg
ttcgacgacacggccggcccgatcgatcccaaccgcctcgtcatccgcctgcagccggac
gagggcgtgaagctgtggctgatgatcaaggaccccggcccgggcggcatccgcctcaca
catgtgccgctcgacatgagcttcgccaaggcgttcaaggtgcgcaatcccgacgcctat
gagcggctgatcctcgacgtggtgcgcggcaaccagaccctgttcatgcgccgcgacgag
gtcgaggcggcctggcgctgggtcgatccgatcctggaggcctggcgcagcgccaaggag
ccgccgcgcccctacaccgccggcacctggggcccgtccgccgccatcgccctcatcgag
cgcgacggccggacgtggctggaggacggcgcgtga

DBGET integrated database retrieval system