KEGG   Starkeya novella: Snov_3925Help
Entry
Snov_3925         CDS       T01258                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sno  Starkeya novella
Pathway
sno00260  Glycine, serine and threonine metabolism
sno00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sno01100  Metabolic pathways
sno01110  Biosynthesis of secondary metabolites
sno01130  Biosynthesis of antibiotics
sno01230  Biosynthesis of amino acids
Module
sno_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Snov_3925
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Snov_3925
Enzymes [BR:sno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Snov_3925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADH91195
UniProt: D6ZZK0
Position
complement(4162528..4163760)
Genome map
AA seq 410 aa AA seqDB search
MNVPNSFRTGPDESGHFGIFGGRFVAETLMPLILDLEKAYNEAKADPAYKAEMDAGLKHY
VGRPSPLYYAERLTEHLRAKSEPGKGAKIYFKREELNHTGSHKVNNVLGQILLARRMGKK
RIIAETGAGQHGVATATLCARYGLECVVYMGAVDVSRQAPNVFRMKMLGATVVPVQSGSK
TLKDAMNEALRDWVTNVDSTFYCIGTVAGPHPYPGMVRDFQSVIGNETREQMLEAEGRLP
DSLIACIGGGSNAMGLFHPFLDDPSVKIFGVEAAGHGIPTGEHAASLTGGRPGVLHGNRT
YLLMDDDGQIAEAHSISAGLDYPGIGPEHSWLHDIGRATYISATDEEALAAFQLVAKLEG
IIPALEPAHALAKVADLAPTFPQDHLMVVNLSGRGDKDIPQVADILGTRL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgttcccaattccttccgtaccggccccgatgagagcgggcatttcggcatattc
ggcggtcgtttcgttgccgaaacactcatgccgctcatcctcgacctagagaaggcctat
aacgaggccaaggccgacccggcctacaaggcggagatggatgccgggctgaagcactat
gtcggccggccgagcccgctctattacgccgagcgcctgaccgagcacctgcgtgcgaag
tccgagcccggcaagggcgcgaagatctatttcaagcgcgaggagctgaaccacaccggc
tcgcacaaggtgaacaacgtcctcggccagatcctgctcgcccgccgcatgggcaagaag
cggatcatcgccgagaccggcgccggccagcacggcgtcgccaccgccacgctctgcgcg
cgctacggcctcgaatgcgtcgtctatatgggcgcggtcgacgtctcgcgtcaggcgccc
aacgtcttccgcatgaagatgctcggcgccaccgtggtccccgtgcagtccggttcgaag
acgctcaaggacgcaatgaacgaggcgctgcgcgactgggtgaccaatgtcgacagcacc
ttctactgcatcggcaccgtcgccggcccgcacccttatccaggaatggtccgggatttc
caaagcgtcatcggcaacgagacccgcgagcagatgctggaggccgagggccggctgccg
gacagcctcattgcctgcatcggcggcggctccaacgccatgggcctgttccatcccttc
ctcgacgatcccagcgtgaagatcttcggcgtcgaggctgccggccacggcatcccgacg
ggcgagcatgccgcctcgctcaccggcggccggccgggcgtcctgcacggcaaccgtacc
tatctgctgatggacgatgacgggcagatcgccgaggcgcactccatctccgccggcctc
gactatcccggcatcggcccggagcattcgtggctgcacgatatcggccgcgccacctac
atctcggcgaccgacgaggaggcgctcgccgccttccagctcgtcgccaagctcgagggc
atcatcccggcgctggagccggcccatgccctcgccaaggtggccgatctcgccccgacc
ttcccgcaggaccatctgatggtcgtcaatctctccggccgcggcgacaaggacatcccg
caggtggcggacattctggggacccgcctatga

DBGET integrated database retrieval system