KEGG   Starkeya novella: Snov_4460Help
Entry
Snov_4460         CDS       T01258                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
sno  Starkeya novella
Pathway
sno00860  Porphyrin and chlorophyll metabolism
sno01100  Metabolic pathways
sno01110  Biosynthesis of secondary metabolites
sno01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Snov_4460
Enzymes [BR:sno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Snov_4460
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Snov_4460
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Snov_4460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 Sirohm_synth_M CysG_dimeriser
Motif
Other DBs
NCBI-ProteinID: ADH91717
UniProt: D7A3U0
Position
complement(4713922..4715421)
Genome map
AA seq 499 aa AA seqDB search
MTDDALRPPAERNAEHASARMAPLARLPVFFALAGRRVVLAGGSEAASWKAELLSAAGAE
VEVFSAEPCEDLRALAADPPAGKVRLVARDWTDADLAGAALAIGAIEDDAEGARFSAAAR
TAGVPVNVVDKPAYCDFAFGAIVNRSPLVVGISTDGAAPVFGQAVRAKIEAVIPQGFKRW
AEAARGWRPSVSALSLSHHGRRRFWERFTEAALETPEAEPTPALRDGLLARAENERSEAS
RGSVTLVGAGPGDPELLTLKAVRVLQSADVVLYDDLVAPAVLDVARREAKKMLVGKTGYK
PSCKQDDINALMVSLAKQGKRVVRLKGGDPMVFGRAGEEISAARNAGIPVEVVPGISAAQ
GASSRLAVSLTHRDHARRLQFITAHARDGKLPRDLDWGALADPAATTVVYMPQRTWGELA
GKAMAAGLDPATPAIAVFSATRPEERQVPATVGTLAAALEQAVADGASGPCLILFGHAMG
EAAAFAGDLEDGESQAARG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacgccctccgcccccctgccgaacgcaacgcagagcacgcctctgcgcgg
atggcgccgctcgcccggctgccggtgttcttcgcgctcgccgggcgccgcgtcgtgctg
gccggcggttcggaggcggcaagctggaaggcggagctgctctccgccgccggcgccgag
gtcgaggtgttctctgccgagccctgcgaggacctgcgcgcgctcgccgccgatccacct
gcggggaaagtgcggctcgtcgcccgcgactggactgacgccgacctcgccggcgccgcg
ctcgccatcggcgccatcgaggacgacgcggaaggcgcgcgcttttccgccgctgctcgc
accgcgggcgtgccggtcaacgtcgtcgacaagccggcctattgcgacttcgccttcggc
gccatcgtcaaccgctcgccgctcgtcgtcggcatctccaccgacggcgccgcgccggta
ttcggccaggcggtgcgggccaagatcgaggcggtgatcccgcagggcttcaagcgctgg
gccgaggccgcgcgcggctggcgcccgtcagtttccgccctctcgctcagccatcacggc
cgccgccgcttctgggagcgcttcaccgaggccgctctggagacgccggaggccgagccc
acgcccgccctgcgcgacggccttctcgcccgcgccgagaacgagcgcagcgaggcttcg
cgcggctcggtcaccctggtcggcgccggtccgggcgacccggaactcctgaccctcaag
gccgtacgcgtgctgcaatcggccgacgtcgtactctatgacgacctcgtcgccccggcg
gtgctcgatgtcgcccgccgcgaggcgaagaagatgctggtcggcaagaccggctacaag
ccctcctgcaagcaggacgacatcaacgcgctgatggtctcgttggccaagcagggcaag
cgcgtcgttcgcctcaagggcggcgacccgatggtgttcggccgcgcgggcgaggagatt
tccgccgcccgcaatgccggcatccccgtcgaggtggtgccgggcatctcggcggcgcag
ggcgcgtcgagccgactcgccgtctcgctcacccatcgcgaccatgcgcggcggctgcaa
ttcatcaccgcccatgcccgcgacggcaagctgccgcgcgacctcgactggggcgcgctg
gccgatcctgccgccaccaccgtcgtctacatgccccagcgcacctggggcgagttggcc
ggaaaggccatggccgctggcctcgatccggcgacgcccgccatcgcggtgttctccgcc
acccggccggaggagcggcaggtgccggccaccgtcggcacgctggcggcggcgctggag
caggcagtggcggacggggcgagcggcccctgcctcatcctgttcggccacgccatgggc
gaggcggcggccttcgcgggtgacctcgaggacggcgagtcgcaggccgcgcggggctga

DBGET integrated database retrieval system