KEGG   Streptococcus pneumoniae AP200 (serotype 11A): SPAP_0451Help
Entry
SPAP_0451         CDS       T01309                                 

Definition
(GenBank) Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
snp  Streptococcus pneumoniae AP200 (serotype 11A)
Pathway
snp00970  Aminoacyl-tRNA biosynthesis
snp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPAP_0451
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:snp03029]
    SPAP_0451
Enzymes [BR:snp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SPAP_0451
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SPAP_0451
Mitochondrial biogenesis [BR:snp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SPAP_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ADM84044
Position
complement(417503..418945)
Genome map
AA seq 480 aa AA seqDB search
MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGI
KAALALNMDIHKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIE
RAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEVIQYAG
ISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFSNVRKGLEYEVQRQAEILRSG
GQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDLPLFEISDEWIEEMRTELPEFPKE
RRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALDGDAKQVSNWLQGEVAQFLNAEGKT
LEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNGGGAREYVEKAGMVQISDPAIL
IPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATKGQANPQVALKLLAQELAKLKEN
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaacagtcatcggacttgaagtccacgtagagctcaacaccaattcaaaa
atcttctcacctacttctgcccacttcggaaatgatcaaaatgccaacactaacgtgatt
gactggtctttcccaggagttctgccagttctcaataaaggggttgtcgatgccggaatc
aaggctgctcttgccctcaacatggacatccacaaaaagatgcactttgaccgcaagaac
tacttctatcctgataaccccaaagcctaccaaatttctcaatttgatgaaccaatcgga
tataatggctggattgaagtcgaactagaagacggtacgaccaagaaaatcggtatcgaa
cgtgcccacctagaggaagacgctggtaaaaacacccatggtacagacggctactcttat
gttgacctcaaccgccaaggggttcccttgattgagattgtatctgaggcagatatgcgt
tctcctgaagaagcctatgcttatctgacagccctcaaggaagttatccagtacgctggc
atttctgacgttaagatggaagaaggttctatgcgtgtggatgccaacatctcccttcgc
ccttatggtcaagaaaaattcggtaccaagactgaattgaagaacctcaactccttctca
aacgttcgtaaaggtcttgaatacgaagtccaacgccaggctgaaattcttcgctcaggt
ggtcaaatccgccaagaaacacgccgttacgatgaagcgaataaagcaaccattctcatg
cgtgtcaaggaaggggctgcagactaccgctacttcccagaaccagacctacccctcttt
gaaatttctgacgagtggattgaggaaatgcggactgagttgccagagtttccaaaagaa
cgtcgtgcgcgttatgtatctgaccttggtttatcagactacgatgctagtcagttgact
gctaataaagtcacttctgatttctttgaaaaagctgttgccctagatggtgatgccaaa
caagtctctaactggctccaaggggaagtcgctcagttcttgaatgctgaaggtaaaaca
ctggaacaaatcgaattgacaccagaaaacttggttgaaatgattgccatcatcgaagac
ggtactatttcatctaagattgccaagaaagtctttgtccatctagctaaaaatggcggt
ggcgcgcgtgaatacgtggaaaaagcaggtatggttcaaatttcagatccagctatcttg
atcccaatcatccaccaagtctttgccgataacgaagctgctgttgccgacttcaagtca
ggcaaacgtaacgccgacaaggcctttacaggattccttatgaaggcaaccaaaggccaa
gccaacccacaagttgcccttaaactacttgcacaggaattggcgaagttgaaagaaaac
tag

DBGET integrated database retrieval system