KEGG   Streptococcus pneumoniae AP200 (serotype 11A): SPAP_0881Help
Entry
SPAP_0881         CDS       T01309                                 

Definition
(GenBank) Cell wall-associated hydrolases (invasion-associated proteins)
Organism
snp  Streptococcus pneumoniae AP200 (serotype 11A)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NLPC_P60 CHAP Amidase_5
Motif
Other DBs
NCBI-ProteinID: ADM84470
Position
831260..833839
Genome map
AA seq 859 aa AA seqDB search
MDKKLKKDFQKKIIRNRDAPEKNMDSKLVHSDDYTNKIIKTKDRFGDKISEKESKLIHEN
VLAKDQKQDKLKDFQKAKNKERIRKEVLDNKNKAGGTKQANLEIRSDESFKFDEDLDVDF
KKVNFDSENSRNINSNKLTTDNISAKAQPISNKKASSKRQVFKNYEDKLIHSKDKFQDKI
NEKESKRIYTSEDKPIEAQKSKRVYRKDKLVKDEVSKNDSNANIDKKQKQKLYQENKFRD
KGKISKEIDKESKLSQVDTEKTFDNSKVNDNNQEFIKDEKEISLNTSEQKKVNKKKTYYK
RKNYESDKFTRKKIDDLKNESKKDTPKDSKKLQDVKDFISDKKIGELEKSKSKLKDNILK
NKTKGSLSSGVLLSGAKSSELVRDYLSSGSDNTGVESGEKAANVSSKLQHGIRKYKLDKK
KKSLKKLSKLDKKIRKRKSKLEFKSGLEDLKKSESYIKKNRFKKFYQRKQMKSMIAKKHE
TRLVDRVKKAILSLGKASKELIVRKSKMVLFLVIGLGLMLSIMIGGGSVGMSGLSNSVNS
VMTTTYLSQDTVLSEVNQEFSSMEYDLQSQIESVKTSHPGYDEYIINKEGEIGHNTHELL
SYITSRCGEVKSASEVKGILKDLFDKMYKLDFKEEIEIRTRTVARTRYDSHGNPYTSYEK
EEYEYKKLIVTLKKKEMDEVVREIFKDYPDNVDHYEALLEAKGNMGDVFGSGNWDLGEIV
DNPNFGNPGLAFDSATAKALFNEAEKHIGKRYVFGASGPSNFDCSGFVCWSFTKSGVKRM
PRTTAWRIYKDYCNPVSPSEAQPGDIIFFHSTYNSGTPISHVGIYAGNGMMIHAGDPIQY
TSINSKYWKSHFYGFGRPR
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaactaaaaaaagattttcaaaagaaaattatacgaaatagggacgctcct
gaaaaaaatatggatagtaaacttgttcattcagatgattatacaaataagattattaag
actaaggataggttcggagataaaatttcagaaaaagaatctaaacttattcatgagaat
gtattagctaaagatcaaaaacaagataaactaaaagattttcagaaggctaaaaacaag
gaaagaatcagaaaagaagttttagataataagaataaggctggaggaacaaaacaagct
aatcttgaaataaggtcagatgaaagctttaaatttgatgaagacttagatgtagacttc
aaaaaggtaaattttgatagtgaaaatagtagaaatattaattctaataagctaacaaca
gataatatttcagctaaggctcaaccaataagcaataagaaggcatcaagtaagagacaa
gtttttaaaaattatgaggataaacttatccatagtaaggataaattccaagacaaaatt
aacgagaaagagtctaagcgaatctacacaagtgaagataaacctatcgaagcacagaaa
agtaagagagtatatagaaaagataagcttgttaaagatgaagtaagcaagaacgacagt
aatgctaatatcgataaaaagcaaaagcagaaactttatcaagaaaataagtttagagat
aagggaaaaatttctaaagaaatagataaagaaagtaagctaagccaagttgatacagaa
aaaacatttgataattcaaaggttaacgacaataatcaagaatttataaaagatgaaaag
gaaataagccttaatacttcagaacaaaagaaagttaacaaaaagaagacttactacaag
agaaaaaattatgagagtgataaatttactcgaaagaaaatcgatgacttaaaaaatgaa
tctaagaaagatacaccgaaagattctaagaaattacaagatgttaaagattttatctca
gacaaaaagattggagagcttgaaaagtctaaaagtaagctaaaggataatattttaaag
aataaaaccaaaggaagtctatcttctggggttttattatctggagctaagtcttcagag
ttagtgagagattatttaagttcaggatctgacaatactggtgtagaatctggagaaaag
gctgctaatgtaagctctaagctccagcatggaataaggaagtataagttagacaaaaag
aaaaagtccttaaaaaagctatctaaacttgataagaaaataagaaagagaaaaagcaag
ttggagtttaaaagtggcttggaagatttaaaaaagtcagaatcctatataaagaaaaat
agatttaagaagttttaccaaagaaagcaaatgaagagcatgatagctaaaaagcacgaa
acaagacttgtagatagggttaaaaaagctattttaagtttaggtaaggcttctaaagag
ctaatcgtaagaaaaagtaagatggttctatttctagtaatagggctaggtcttatgcta
tcaatcatgattggtggtggaagtgttggtatgagcggattaagtaactctgtaaactca
gtaatgacaacaacatacctatcacaagatacagttctaagtgaagtaaatcaagaattt
tcatcaatggagtatgacctacaatcgcaaatcgaaagtgtaaaaacaagtcatcctgga
tatgacgaatatatcataaacaaagaaggagaaattggtcataatacccatgaactttta
tcctatataacttcaagatgtggagaagtaaaatcagcatctgaagtaaaaggaatttta
aaagatcttttcgataaaatgtataagcttgattttaaggaagaaattgaaattagaaca
agaacagtagcaagaactagatatgatagtcatggtaatccttatactagctatgaaaaa
gaagagtacgaatataaaaagttaattgtaactttaaagaaaaaagaaatggatgaagtt
gttagggaaatatttaaagattatccagacaatgtagatcattatgaagctcttcttgaa
gctaaggggaacatgggagatgtttttggatcaggtaattgggacttaggagaaatagta
gataatccaaactttggaaatcctggtcttgcttttgattcagctactgcaaaggctctt
tttaatgaagcagaaaaacatataggcaaaagatatgtgtttggagcaagtggaccatct
aactttgactgctcaggttttgtatgttggtcatttacaaagtctggtgtaaagagaatg
ccaagaacaactgcatggagaatatacaaagactattgtaatccagtaagtccaagtgaa
gctcaacctggagatattatatttttccactcaacatataacagtggaacaccaatatct
catgtaggcatatatgcaggtaacggaatgatgattcacgcaggagatccgattcaatac
acatcaataaattcaaaatattggaaatcacacttttatggttttggaagacctagatag

DBGET integrated database retrieval system