KEGG   Streptococcus pneumoniae AP200 (serotype 11A): SPAP_0883Help
Entry
SPAP_0883         CDS       T01309                                 

Definition
(GenBank) hypothetical protein
Organism
snp  Streptococcus pneumoniae AP200 (serotype 11A)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cu_amine_oxidN1 SHE3 ATG16 DUF3450 Spc7 Fib_alpha HrpB7 ING Fez1 PKcGMP_CC CtIP_N DUF1664 ERM PspA_IM30
Motif
Other DBs
NCBI-ProteinID: ADM84472
Position
834080..835663
Genome map
AA seq 527 aa AA seqDB search
MKKFNTNRLRAFFMALLLVLTSTSTTNVLAKADDTDGSKKVIESSISNINDLENQIKDLN
DKKQEDQSKIDELKEKLESCKDNGEKLKQEKTKLEEEIRDKDNKIAQLEKEIEGLKNSNN
DELIAEITQLKDELKRLQDENVKLKEDYSSTKWELEAEKEKTDKNENKIKEMQEKLESLE
EELAKKTKEIEDKDNKIKDLEKALDEKDNKIKELENKKKETENSKSECFKKIEELQKAID
SLKESSENTKKELEEKIKGLEEKQKASEEEIKKLKEELDKKIEEAKKLIEEANKKAKEEL
EKQTKDEKDKNQNQDLSKKLDELLKLQKENKEKKEEKKSQDKKWDELLKADDKNILNQFD
LNKMKKQEEQQDKKQVKDEKEFAVFQVDKNFYNIINKDGKTTVYMDVKTYVDQGRTMIPV
RYIAYTLGFNVEYDNSTREAIFSNKENNILAKKTLRLNIDTGVMKDSDGKVYNSDVKPVI
INGRIHASISNIAKAFGASHGDIKDGKNQTIEWDNARKAVYVFKNVK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatttaatacgaacagactaagagccttttttatggctcttttattagtttta
acatcaacctcaactactaatgtactagctaaagctgatgatacagatggtagtaaaaaa
gttatagagagttctataagtaatattaatgatttagaaaatcaaatcaaagacttaaat
gataagaaacaagaagaccaatcaaagatagatgaattaaaagaaaaattagaatcttgc
aaagataatggagagaaactaaaacaagaaaaaactaagttagaagaagagattagagat
aaagacaataagattgctcaattggaaaaagaaattgagggacttaaaaattctaacaat
gatgaactaatagcagaaattactcagcttaaagatgaattaaaaagattacaagatgaa
aatgtaaaactaaaagaagattattcatctacaaaatgggagttagaagctgagaaagaa
aagactgataaaaacgaaaataaaatcaaagaaatgcaagaaaagctcgagtctttagaa
gaggaacttgcaaagaagactaaagaaattgaggataaagataataaaattaaggactta
gaaaaagctcttgatgaaaaagataataagataaaagaattagagaataaaaagaaagag
acagaaaattctaagtcagaatgctttaagaaaattgaagagcttcaaaaggctattgat
agtttaaaagaatcttctgaaaatacaaaaaaagaattagaagagaagattaaaggacta
gaagaaaaacaaaaagcttctgaagaagaaattaaaaagttaaaagaagaattagataag
aaaattgaagaagcaaagaagttaatcgaggaagcaaataaaaaagcgaaagaagaactt
gaaaaacaaacaaaagatgaaaaagataaaaatcaaaatcaagatttatctaagaaatta
gatgaacttctaaaactccaaaaagaaaacaaagaaaagaaagaagagaagaaatctcaa
gataagaagtgggacgaacttttgaaagctgatgacaagaacattctaaatcaatttgat
cttaacaagatgaaaaagcaagaagaacaacaggacaaaaaacaagttaaagatgaaaaa
gaatttgcagtttttcaagtagacaaaaacttttataacattatcaacaaagatggtaag
acaacagtatatatggatgtaaaaacttatgtggatcaaggaagaactatgattccagta
agatatattgcttatactctaggttttaatgttgagtatgacaactctactcgtgaagct
attttctcaaataaagagaataatatcttagctaaaaagacattaagactaaatattgat
actggtgttatgaaagattcagatggaaaggtctacaattcagatgttaagccagtgatt
ataaatggaagaattcatgcttcaatttcaaatattgctaaagcttttggagcaagtcat
ggagatattaaagatggcaaaaaccaaacaatagaatgggacaatgctagaaaagcagtc
tatgtatttaaaaatgtaaaataa

DBGET integrated database retrieval system