KEGG   Streptococcus pneumoniae AP200 (serotype 11A): SPAP_0885Help
Entry
SPAP_0885         CDS       T01309                                 

Definition
(GenBank) hypothetical protein
Organism
snp  Streptococcus pneumoniae AP200 (serotype 11A)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TBPIP DUF507 CRS1_YhbY SMRP1
Motif
Other DBs
NCBI-ProteinID: ADM84474
Position
836656..837231
Genome map
AA seq 191 aa AA seqDB search
MILTHIKYFLSNDFLDIASNATVRQILKRLADEDKIKRVIDGFYYNPKYSELIGEYEAVS
IHELALAIARKYNWNIAPYSSTALNLLGLSTQVPTHYKYISSGRYKEYKIGDTVLEFKKV
NPGEIANMSLKTATVIQAIKSLGKEDITREVIQKIRENLTEKERIDLTNESKSVPAWVYE
VIREICEGKNE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgattttgactcacataaagtattttttgtcaaatgactttttagatattgcatctaat
gctacggttagacaaatactaaaaagattagcagatgaagataaaatcaagcgcgtcatc
gatggcttttattacaatccaaaatacagtgagttaattggagaatatgaagcagtatca
attcacgagttggcacttgccatagcaagaaaatacaattggaatattgcaccatatagt
agcacagccttaaacctattaggactttcaacacaagtaccaactcactacaaatatata
tctagtggaagatacaaagaatataaaattggggatacggttttagaatttaaaaaagta
aatccaggagaaattgccaacatgtccttaaagactgcaacagttattcaagcaattaag
tctttaggtaaagaagatataaccagagaagttatacaaaagataagagaaaacttaact
gaaaaagaaagaatagacttaacgaacgaatcaaaatcagttcctgcatgggtatatgaa
gtaataagggaaatttgtgagggcaaaaatgaataa

DBGET integrated database retrieval system