KEGG   Streptococcus pneumoniae AP200 (serotype 11A): SPAP_0889Help
Entry
SPAP_0889         CDS       T01309                                 

Definition
(GenBank) DNA methylase
Organism
snp  Streptococcus pneumoniae AP200 (serotype 11A)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ResIII SNF2_N Helicase_C SWI2_SNF2 DEAD IF2_N
Motif
Other DBs
NCBI-ProteinID: ADM84478
Position
840966..847262
Genome map
AA seq 2098 aa AA seqDB search
MQVNDFKNIQEAIKYEVLQDEKEYLKLLKVIGNNQKYDFSSQLSIYNKEPEARACATFDM
WKKYFGRVVMRGQKGIPILVGSDINQRVSYIFDISQTTSMDRNINEVSLWQFDHENHNRA
LKEIIRDFSFEASDSLNENMFSLSRIYGDEYINLALADLRIDIEDRLSFEKFMRDSISYA
VANRFNTVYPMDMENLKNNFSRINTISLEQIGLVVSRVSEDIIDRTIEKSKEMDRARLLT
ERDAADYNRDIENINDNRGGQNDLYRRDDRARSGDGRVFTDGSDRGNSDEDRREDLGHDG
EGSGIYGEISESDLRGSETVLPGRERGHGELEETSGNVRGENTFEPPEGNSESGSGLYQE
RESQNDESTRIDREDDERESRGIPRTDEQLDGNSQENGNQGIRGSLENEISQEKEADEAS
FFDGKNIQNRKDYWIVEFNENHELVPDYSGQIVTKDLINVLRQKDIDVKDHNQTLGENEF
GEMTDDYIGYFKFYFDHYVDGEVARHYRIDLGDGEEANEREFSYLEEQAALSEEKASQEE
IKEKIEPKFKIGDQVRYKDKDFTITDFDELSGGLKTVTIRDNMEYMGGMIRGSEVIPYRN
DSYLEEIFENLSQTSEKLAVKVGKEFILEDENTFNGIKLIETGTKVEINGEEFPLYKGET
FEESRKIDDLLDSGNYEIHKLSEHEKQIERQVEQESFIDNYNPEIDQMMDKYNVPREAAE
NLLRGKEDLKNLGYESNKERLSFARNYDLKNHIYSEYLTPSEKLDKNIKAIKMLKRLENE
NRSPREYEQAYLADYLGWGGLADVFDEEKGGQWLEARNILKENLTNEEYLNAKESILTSF
YTPREVMDGIYKTLTDMGFKTGNILEPSAGVGNFIGNMPSEIKGYKVYGVEKDSLSGRIA
RELYPEANIQIKGFEETNFSNNFFDLVIGNVPFGDFKVNDREYNRNNFLIHDYFFAKSID
KVRNGGIIAFITSSGTMDKKDESVRKYINSRCEFLGAMRLPNTTFKGLAGTEVTSDIIFL
KKRDSVIERDDDWIHLATDKKGLTYNKYFVDNPQMVLGDMKEVSGRFGNTITCDEKEDEN
LKDLMDLASKEISSNSKYEEVELLEDEELSLPATDDVKNFSYTIIDEEVYLRENSVLIKQ
NISEKNKEKIKDYLDVMNALKDVIEKQKDDFSDEEIKESQAKLNEVYDNFSKKHGFINSL
SNTRALKEDSNYPLVSSIEILDDEDNFKAKSDIFSKRTITKAKVVDHVDTSLEALVLSVS
QKGYVDFEYMESITSKDRDTLIGELEGEIFLDIKDTDLINNRMPFENFNNDDSFHFSYVS
ADEYLSGNIREKIGYLNSYIGEIENVIDLAPSEKKDTLLNELGKLKYQREKLQEVMPEEL
TASDINVRLGATWIPQKDIEDFTFNLLKTPGYDRWNINVRFSPHTSEWNIEGKSVDSTND
LANMTYGTSRVNAYKLIENALNLKDTKVFDQVINDDGSKTSVLNKKETMLASQKQELIKE
EFKNWIFEDPDRRYRLEKIYNEKFNSIRNREFDGSNLTFDGMNTEIRLREHQKNAIARTL
YGGNTLLAHVVGAGKTFEMVASAMESKKLGLASKSLFVVPNHLTTQIGREFMQLYPSANI
MVADKKDFQPKNRKRFIGRIATGEYDAVIIGHSQFEKIPMSKEYQVRHIQDQIDDIVSFI
DENKRNRGENFTVKQLEKTKKKLLVRLEKLNDDFKKDDVITFEELGVDKLFIDEAHNYKN
LFLHTKMRNVAGIGQSEAFKSSDMYMKCRYMDEMTDGKGVVFATGTPISNSMTELYTMQR
YLQYDDLKARGLEHFDAWASTFGETENTFELSPEGTGYRQKTRFSKFYNLPELMSMFKEV
ADIKTSDMLNLPVPEANFEVIKTKPTEEQKEILEAISERADAVRNNQVEPTEDNMLKITN
DGKKLALDQRLINPLLPDDPNSKVNVCVKNIFSIWDKTKENLSTQLVFSDMSTPKGDGEF
NIYDDIRNKLVNMGIPKEEIAFIHEADTDKQKDELFSKVRRGEVRVLLGSTQKMGAGTNV
QNKLIALHDLDVPWRPSDLEQRSGRIVRQGNENDKVNIFRYVTENTFDAYLWVRHEVA
NT seq 6297 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaaatgattttaagaatatacaagaagcaataaagtatgaagttttacaagat
gaaaaagaatatttaaaactcttaaaagttataggcaacaatcagaaatatgatttttct
agccaattaagtatatataacaaggaacctgaagctagagcttgtgcgacttttgatatg
tggaaaaaatattttggtcgagttgttatgagaggtcaaaagggtattccaattttagtt
ggaagtgatataaatcaaagagtttcatatatttttgatattagtcagaccacatcaatg
gataggaatattaatgaggttagcttatggcagtttgaccacgaaaaccataatagggct
ttaaaagaaataataagagatttttcatttgaagctagtgattcacttaatgaaaatatg
ttttctttaagtcgaatttatggagatgaatatattaacttggctcttgctgacttgaga
atagatatagaggatagactgagttttgaaaagtttatgagagactcaatatcctatgcg
gtagctaataggtttaatacagtctatcctatggatatggaaaatttaaaaaataatttt
tctaggattaatacaatttctttagagcagataggtcttgtagtatcaagggttagtgaa
gatattatagatagaacaatagaaaaatctaaggaaatggatcgtgctaggctgctgaca
gaaagggacgctgccgactataatagagatatagaaaatataaatgataatagaggaggt
caaaatgatttatatagacgagatgatagggcaagaagtggagatggacgagttttcaca
gatggaagcgacagaggaaatagcgatgaagatcgaagagaagaccttggacatgatgga
gaaggatctggaatttatggagagatttccgaatccgacttacgcggttctgagactgtc
ttacctggtagggagcgaggacatggagaactggaagaaacttcaggaaatgtacgagga
gaaaacacttttgaaccacctgaaggaaattcagaatcaggcagtggactttatcaagag
agagaaagtcaaaatgatgaaagcacaaggattgacagagaagatgatgagagagaatcc
agaggaataccaaggacagatgaacaacttgatggcaacagtcaagaaaatggcaatcaa
ggaatacgtggaagcttagaaaacgaaataagccaagaaaaggaagctgatgaagcttct
ttttttgatggcaaaaacattcaaaatagaaaagactactggattgtagaatttaatgaa
aaccacgaattagttcccgattatagtgggcagatagtaactaaagatttaattaatgtc
ctaagacaaaaagatattgatgttaaagaccataatcaaactcttggagaaaatgaattt
ggagaaatgactgatgattatatcggatatttcaaattctattttgatcactatgtagac
ggagaagttgcccgtcattataggattgaccttggtgatggtgaagaagcaaatgagcgt
gaattttcatatttagaagaacaagctgcactaagtgaggaaaaagcttcacaagaagaa
attaaggaaaagatagagcctaagtttaagataggagatcaggttagatataaagataag
gactttaccattaccgattttgacgaactaagtggaggacttaaaactgtaactatcaga
gataatatggaatatatgggaggtatgattaggggttcggaagtaattccatatagaaac
gattcataccttgaagaaatctttgaaaatctaagtcaaacatcagaaaaactagcagta
aaagttggtaaggaatttattttagaagatgagaatacctttaatggaattaaattaatt
gaaacaggaactaaagtagaaatcaatggcgaagaatttcctttatataagggcgaaaca
tttgaagaaagtagaaagattgatgaccttttagatagtggaaactatgagatacacaaa
ttatctgagcatgaaaaacaaattgaaagacaagtagaacaagaaagctttattgataac
tataatccagaaattgaccaaatgatggataaatacaatgtgcctagggaagcagccgaa
aacttattgaggggtaaagaagatttaaagaatctaggctatgaatctaataaggaaaga
ctaagttttgctagaaattatgacttgaaaaatcatatctactcagaatacctaacacca
tcagaaaagctagataaaaatatcaaagctattaaaatgctaaaaagacttgaaaatgaa
aataggagtccaagagaatatgaacaagcctatcttgctgactatctaggttggggaggt
cttgccgatgtctttgatgaagaaaagggaggacaatggctcgaagcaaggaatatttta
aaggaaaatctaacaaatgaagagtatttgaatgctaaggagtctattttaacatcgttt
tatacacctagagaggtaatggatggaatatataagactctaacagatatgggatttaag
actggaaatatccttgaaccatctgcaggggtcggtaattttattggtaatatgccaagt
gaaataaaaggctataaagtctatggagtagaaaaagatagtctaagcggaagaatagca
agagaactttatcctgaagctaacattcaaattaaaggttttgaagaaacaaacttctca
aataatttctttgacttggtaataggaaatgttccctttggagattttaaagttaacgat
cgtgaatataacagaaataattttctgattcacgattatttttttgcaaagtcaatagat
aaggttaggaatggaggaattattgcctttataacctcatctggaactatggataaaaaa
gatgaatctgttagaaaatatattaattcaagatgtgagtttttaggagctatgaggctt
cctaatacaacatttaaaggacttgctggtacagaagttacttcagatattattttcttg
aaaaagagagattcagttatagaaagagatgatgattggattcatctagcaactgataaa
aagggtttgacttataataaatactttgtagataatcctcaaatggtattaggggatatg
aaagaagtatctggaagatttggaaatactattacttgtgatgaaaaagaagacgaaaat
ttaaaagatttaatggatcttgcaagtaaggaaatatcttcaaattcaaaatatgaagag
gttgagctattggaagatgaagaattaagtcttccagcaacagatgatgttaagaatttt
tcttacaccattattgatgaagaggtctacctaagagaaaactcagtcttaataaagcaa
aatatatcagaaaaaaataaagaaaagataaaagattatcttgatgtaatgaatgcttta
aaagatgtaatagaaaagcaaaaagacgatttttctgacgaagaaataaaagagtcacaa
gcaaagttaaatgaagtctatgataacttttcaaagaaacatggctttattaactcctta
tcaaacaccagagccttaaaggaagactcaaactatcctttggtttcatcaatagaaata
cttgatgatgaggataatttcaaagctaagagtgatatattctcaaaaagaacaataaca
aaggcaaaagtagtagaccatgtagatacttcccttgaagctttagtcttatctgtttca
caaaaaggatatgtagactttgaatatatggaatctatcacaagtaaagatagggacacc
ttaattggtgaacttgagggtgagatatttttagatattaaggacacagacctaataaat
aacagaatgccctttgagaactttaacaatgacgattcatttcatttttcatatgtatcg
gctgatgagtatctaagtggcaatattagagaaaagattggctacctcaattcatatatc
ggagaaattgaaaatgtaatagatttagcaccttctgaaaagaaagacacattattaaac
gagttaggcaaactcaaatatcaaagagaaaaattacaagaagttatgcctgaagaactc
actgcttctgatataaatgtaaggttaggagcaacttggatacctcaaaaagatatagaa
gactttacttttaaccttttaaaaacaccaggttatgataggtggaatataaatgttagg
ttctcaccacatacaagtgaatggaatattgaaggtaaaagtgttgactcgactaatgac
cttgctaacatgacttatggtacaagtagggtaaatgcctataagctaattgaaaatgct
cttaatctaaaagatacaaaggtatttgaccaagtaataaatgatgatggttctaagact
tctgtattaaataaaaaagaaactatgcttgcaagtcaaaagcaagaactgattaaagaa
gaatttaagaattggatatttgaagatcctgatagaagatataggctagaaaagatttat
aatgaaaaattcaattctattaggaatagagaatttgatggttctaacttaacttttgat
ggaatgaatacagaaatcagacttcgagaacatcagaaaaacgctatagcaaggactctt
tatggtggaaatacactccttgcccatgtagtaggagcaggaaaaacttttgaaatggta
gcttctgctatggaatctaaaaagttaggacttgcaagtaagtcattatttgtagttcct
aaccatctaaccactcaaattggtagagagtttatgcaattatatccgtcagcaaatatt
atggtggccgataaaaaagacttccaacctaaaaataggaaaagatttattggtaggatt
gcaactggagaatatgacgcggtcatcataggacactctcaatttgaaaaaatacctatg
tctaaggaataccaagtaaggcatatacaagaccaaatagatgatatagtttcctttatt
gatgagaacaaaagaaatagaggagaaaatttcacagttaaacaactggaaaagacaaag
aagaagcttttggtaagacttgaaaaactaaatgatgactttaaaaaggatgatgtaata
acctttgaagaactaggagtagataagttatttatagacgaagctcataattacaaaaac
ttattcttgcatacaaagatgagaaatgtggctggtatcggtcagagtgaagcatttaag
tcttctgatatgtatatgaaatgtaggtatatggatgaaatgacagatggaaagggagtt
gtatttgctactggtacaccaatatcaaattcaatgacagagctttatactatgcagaga
taccttcaatatgacgatttaaaggcaagaggattagaacattttgatgcctgggcttct
acttttggagaaacagaaaacacctttgaattatctccagaaggcactggatataggcaa
aagacaagattttcaaagttctataacttgccagaacttatgtctatgtttaaagaagta
gcagatataaagacttcagatatgttaaatttgccagtgccagaagcaaattttgaagtt
attaaaacaaaacctactgaggaacaaaaagaaatattagaagctatttcagaaagagct
gatgcggttagaaacaaccaagtagagccaacagaagataatatgctaaagattacaaat
gatggtaaaaaacttgcccttgaccaaagattaataaacccactacttccagatgatcct
aattcaaaagttaatgtatgcgttaaaaatatcttttcgatctgggataagacaaaagaa
aatttatcgacccaattagtgttttcagatatgtccacaccaaaaggagatggagaattt
aatatctatgatgatattagaaataagctagtgaatatgggaataccaaaagaagaaata
gcctttatccacgaagcagatacagacaaacaaaaagatgaactattctccaaggtaaga
agaggagaagtaagggtattattaggctctactcaaaaaatgggagcaggtacaaatgta
caaaataaactaatagccttacacgatttagacgtcccatggagaccgtctgacctagag
caaagaagtggtagaattgttcgtcaaggtaatgaaaatgataaggtaaatatctttaga
tatgtaacagaaaatacttttgatgcttatttatgggtgcgacatgaagtcgcttaa

DBGET integrated database retrieval system