KEGG   Streptococcus pneumoniae AP200 (serotype 11A): SPAP_0890Help
Entry
SPAP_0890         CDS       T01309                                 

Definition
(GenBank) Retron-type reverse transcriptase
  KO
K00986  RNA-directed DNA polymerase [EC:2.7.7.49]
Organism
snp  Streptococcus pneumoniae AP200 (serotype 11A)
Brite
KEGG Orthology (KO) [BR:snp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPAP_0890
Enzymes [BR:snp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     SPAP_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RVT_1 RVT_N GIIM
Motif
Other DBs
NCBI-ProteinID: ADM84479
Position
847818..849353
Genome map
AA seq 511 aa AA seqDB search
MNSKMCATTNRAKDWESIDFSLAESYVKKLQMRIVKAWKMSKYGKVKSLQHLLTTSFYAK
ALAIKRVTENQGKKTSGVDGELWLTPQAKYKAIEKLNLRGYKPKPLKRVYIPKKNGKKRP
LSIPTMTDRAMQTLYKFALEPIAETTADPNSYGFRAKRCTQDAIEQCFTSLNKKKSAKWV
LEGDIKGCFDNISHEWILNNIPMNKKLLKLWLECGYIEKQKLFPTETGSPQGSPISPIIS
NMVLDGLEKAIKEKYHRRTVNKKTYFPKVNFARYADDFIVTGESAELLENGVKPIIVKFL
AERGLELSEEKTLITHINDGFDFLGVNIRMYKDKLLTKPSDKNFKAIVDKIRRIIKDNPS
MKQEILIRKLNPIIIGWVNYQKYNVSSKAFEKLDYEIYKSLWTWCVRRHPKKGRKWIAKK
YFHTIGNRIWTFSVATGDRMENGEKYYLRLKYATDTDIKRFTKIQAEANPFDENWQIYFE
EREELKIRNELKGRTVINRLYKTQNGICPVC
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtaaaatgtgtgctactactaacagagctaaagactgggaaagtatagatttt
tctctagcagaaagctatgttaaaaaactacaaatgcgtattgtgaaagcgtggaaaatg
agtaaatacggaaaggtaaaatctttacaacatttactcacaacttcattttatgcaaaa
gccttggctattaagagggtaactgaaaatcaaggcaagaaaacaagtggtgtagatggc
gaattatggctaacaccacaggcaaagtataaggcaatagaaaagttaaatttaagagga
tataaacctaagcctcttaaaagagtgtatataccaaagaaaaatgggaagaaaagacct
ctcagcattcctacaatgacagatagagcaatgcaaaccctatataaatttgcacttgaa
cccatagcagaaactactgctgaccctaattcttatggatttagggcaaaaagatgtaca
caagatgctatcgagcagtgttttacatcacttaataaaaagaaatctgcaaaatgggta
cttgagggagatataaaaggttgttttgataatataagtcatgaatggatattaaataat
atcccgatgaacaagaaattattaaaactctggcttgagtgtggatatatagaaaaacaa
aaactatttccaacagaaacaggaagtccccaaggctcgccaatatcacctattatttcc
aatatggtattagatggtttagaaaaagcaatcaaagagaaataccatagaagaacagta
aataagaaaacatatttcccaaaggttaactttgctagatatgcagatgatttcatcgtt
acaggggaaagtgcagaattgcttgaaaatggtgtaaagccaatcattgtaaaattcttg
gctgaaagaggtttagaattatcagaggaaaagacactcataacacacataaatgacggt
tttgattttcttggagttaatattaggatgtataaagataagttgcttacaaaaccatct
gataagaacttcaaggctattgtcgataaaatcagacgaatcataaaagataatccgtca
atgaaacaagaaatattgattagaaaactaaatccaatcattataggttgggtaaactat
cagaaatataatgtttcatctaaagcctttgaaaaacttgattatgaaatatataaaagc
ttgtggacctggtgcgttcgtagacacccaaagaaaggtagaaaatggatagctaagaaa
tacttccataccattggaaatagaatctggactttcagtgtagcaactggtgacagaatg
gaaaatggcgagaaatactatcttcgtcttaaatatgctacagatactgatattaaaaga
tttaccaagatacaagctgaagcaaatccatttgatgaaaattggcaaatatactttgaa
gaaagagaagagttaaaaatacgaaacgaacttaaaggacgtacagttataaatagactg
tataaaacgcaaaatggaatatgccctgtttgttga

DBGET integrated database retrieval system