KEGG   Streptococcus pneumoniae AP200 (serotype 11A): SPAP_0897Help
Entry
SPAP_0897         CDS       T01309                                 

Definition
(GenBank) hypothetical protein
Organism
snp  Streptococcus pneumoniae AP200 (serotype 11A)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Choline_kinase EcKinase RIO1 DUF4135
Motif
Other DBs
NCBI-ProteinID: ADM84486
Position
857122..857646
Genome map
AA seq 174 aa AA seqDB search
MQLIREDFSLPFLKQLKQVLRKECASLPMDLKCLLGAHIKPLEQSIDRVEGLSEILRRSN
PKMALCHTDIHNWNLMQRDEQLVLIDWEGLKLAPVKADLMFFVDKPYYDVFMNIYLKLHK
DFLINTDALLFYHIRRKLEDIWEFIEQLLYDNQEDKERNETIKVLDGELNNLVF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgcaactaattagggaagattttagcttgccatttctgaaacagctaaaacaagtattg
cgtaaagaatgcgccagtcttcccatggacttaaaatgcttgcttggggcacacataaaa
ccccttgaacaatctattgacagagttgaaggactgtcggagattctaagacgaagtaat
cctaaaatggccctatgccatacagatattcataattggaacttgatgcaacgggatgag
cagttagttctaattgactgggaaggcttgaaattggctccagtaaaagctgatctcatg
ttttttgttgataagccatattatgatgtatttatgaacatatacctgaaattacacaaa
gattttttaatcaatacggatgctttgttattctatcatattagacgtaaactagaagat
atatgggagtttattgaacaacttttatatgacaatcaagaggataaggaaagaaatgaa
actataaaagttcttgatggtgaactgaataacttagtgttttga

DBGET integrated database retrieval system