KEGG   Streptococcus pneumoniae AP200 (serotype 11A): SPAP_0905Help
Entry
SPAP_0905         CDS       T01309                                 

Definition
(GenBank) Predicted Zn peptidase
Organism
snp  Streptococcus pneumoniae AP200 (serotype 11A)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M78
Motif
Other DBs
NCBI-ProteinID: ADM84494
Position
complement(863159..863707)
Genome map
AA seq 182 aa AA seqDB search
MSMNRYIYDKVNRLIKKYKTRDPIELIEALNINLVYLPETKILLGMYHYIQRNRFIFISS
NTNFNRKTILAHELGHDQLHRDYCMSGGAFHDQTVLNPTNKFETEANIFAAHLLISDEDV
FDNINDQVCDYEIAGKLGVDINLLNLKISELAKMGKFNKPINVNTPQGDFLKNYRPEHDD
YY
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgaatcgctatatatatgataaggttaatcgacttataaaaaaatataagaca
cgagatcctatcgaattaatagaagctttgaatattaatctggtatatctgcctgaaaca
aaaatacttttaggaatgtaccattatattcaaaggaacagatttatttttatcagtagc
aacacaaattttaatagaaagactatattagcacatgaattaggtcacgatcaactacac
agagattattgtatgagtggtggagcttttcatgaccaaacagtgctaaaccctacaaat
aaatttgaaactgaagcaaatatttttgcagctcatttattaattagtgatgaagatgtc
ttcgataatataaatgatcaagtttgtgattatgaaattgctggaaaattaggtgtagat
ataaatttactaaatctaaaaatttctgagttagcaaaaatgggcaagtttaataaacca
attaatgttaatacccctcagggagattttcttaaaaactatcgccctgaacatgatgat
tattattag

DBGET integrated database retrieval system