KEGG   Streptococcus pneumoniae AP200: SPAP_1595Help
Entry
SPAP_1595         CDS       T01309                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
snp00010  Glycolysis / Gluconeogenesis
snp00051  Fructose and mannose metabolism
snp00562  Inositol phosphate metabolism
snp01100  Metabolic pathways
snp01110  Biosynthesis of secondary metabolites
snp01120  Microbial metabolism in diverse environments
snp01130  Biosynthesis of antibiotics
snp01200  Carbon metabolism
snp01230  Biosynthesis of amino acids
Module
snp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
snp_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:snp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPAP_1595
   00051 Fructose and mannose metabolism
    SPAP_1595
   00562 Inositol phosphate metabolism
    SPAP_1595
Enzymes [BR:snp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPAP_1595
Exosome [BR:snp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPAP_1595
  Exosomal proteins of bladder cancer cells
   SPAP_1595
  Exosomal proteins of melanoma cells
   SPAP_1595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADM85181
Structure
PDB: 

Position
complement(1503162..1503920)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVVSKLPSSDLVEAGIAAPALDLTTVLAVAKGSNL
KVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagttgtatcaaaacttccttcatcagatcttgttgaagcaggt
atcgctgctccagctcttgatttgacaactgttcttgctgttgcaaaaggctcaaacctt
aaagttgctgctcaaaactgctactttgaaaatgcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactacgttgttatcggtcactcagaacgccgt
gactacttccatgaaactgacgaagatatcaacaaaaaagcaaaagcaatctttgcgaac
ggtatgcttccaatcatctgttgtggtgaatcacttgaaacttacgaagctggtaaagct
gctgaattcgtaggtgctcaagtatctgctgcattggctggattgactgctgaacaagtt
gctgcctcagttatcgcttatgagccaatctgggctatcggtactggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgttcgtgacgttgtagctgctgactttggt
caagaagtcgcagacaaagttcgtgttcaatacggtggttctgttaaacctgaaaatgtt
gcttcatacatggcttgcccagacgttgacggtgcccttgtaggtggtgcgtcacttgaa
gctgaaagcttcttggctttgcttgactttgtaaaataa

DBGET integrated database retrieval system