KEGG   Streptococcus pneumoniae AP200 (serotype 11A): SPAP_2124Help
Entry
SPAP_2124         CDS       T01309                                 

Definition
(GenBank) Arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
snp  Streptococcus pneumoniae AP200 (serotype 11A)
Pathway
snp00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:snp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPAP_2124
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:snp01007]
    SPAP_2124
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:snp03016]
    SPAP_2124
   03029 Mitochondrial biogenesis [BR:snp03029]
    SPAP_2124
Enzymes [BR:snp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     SPAP_2124
Amino acid related enzymes [BR:snp01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   SPAP_2124
Transfer RNA biogenesis [BR:snp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SPAP_2124
 Prokaryotic type
   Other AARSs
    SPAP_2124
Mitochondrial biogenesis [BR:snp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SPAP_2124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N AvrM-A DUF455
Motif
Other DBs
NCBI-ProteinID: ADM85655
Position
1965978..1967669
Genome map
AA seq 563 aa AA seqDB search
MNTKELIASELSSIIDSLDQEAILKLLETPKNSEMGDIAFPAFSLAKVERKAPQMIAAEL
AEKMNSQAFEKVVATGPYVNFFLDKSAISAQVLQAVTTEKEHYADQNIGKQENVVIDMSS
PNIAKPFSIGHLRSTVIGDSLSHIFQKIGYQTVKVNHLGDWGKQFGMLIVAYKKWGDEEA
VKAHPIDELLKLYVRINAEAENDPSLDEEAREWFRKLENGDEEALALWQWFRDESLVEFN
RLYNELKVEFDSYNGEAFYNDKMDAVVDILSEKGLLLESEGAQVVNLEKYGIEHPALIKK
SDGATLYITRDLAAALYRKNEYQFAKSIYVVGQEQSAHFKQLKAVLQEMGYDWSDDITHV
PFGLVTKEGKKLSTRKGNVILLEPTVAEAVSRAKVQIEAKNPELENKDQVAHAVGVGAIK
FYDLKTDRTNGYDFDLEAMVSFEGETGPYVQYAYARIQSILRKADFKPEIAGNYSLNDTE
SWEIIKLIQDFPRIINRAADNFEPSIIAKFAISLAQSFNKYYAHTRILDESPERDSRLAL
SYATAVVLKEALRLLGVEAPEKM
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaaaagaattgattgctagcgaattatctagcatcattgatagcctggaccaa
gaggctattttaaagttactggaaacccctaaaaactcagaaatgggagacattgctttc
cctgctttttctcttgcaaaagtcgaacgtaaagcaccacaaatgattgcggctgaactg
gctgaaaaaatgaacagccaagcctttgaaaaagttgtcgcaacaggaccttacgttaac
tttttccttgataaatctgccatttctgctcaagtattgcaagctgttaccactgaaaaa
gaacactatgctgaccaaaatattggcaaacaagaaaatgttgttatcgacatgtctagt
ccgaatatcgctaaaccattttctattggccacctgcgttcaactgttatcggagatagc
ttgtcacatattttccaaaaaatcggttatcaaacggtcaaggtcaaccatttgggagac
tggggtaaacaatttgggatgttgattgttgcctacaaaaaatggggcgacgaagaagct
gtaaaagctcatccaatcgatgaactccttaaactctatgtccgcatcaacgctgaagct
gaaaatgaccctagcttggatgaagaagcgcgcgaatggttccgtaaacttgaaaatgga
gatgaggaagctctcgctctttggcaatggttccgcgatgaaagtttagtggaatttaac
cgcctttacaatgaattgaaggttgaatttgacagctataacggagaagccttctacaat
gataagatggatgcagttgtagacattctttctgaaaaaggactacttcttgaatcagaa
ggtgcccaagttgtgaatcttgagaaatatggaattgaacatccagccctcatcaagaag
tctgatggtgcaactctctatatcacacgtgacttggctgcagccctctaccgtaaaaat
gaataccaatttgctaaatctatctacgtcgttggtcaagagcaatctgcccactttaaa
caactcaaagctgtcttgcaagagatgggctacgattggagtgacgacattacccacgtt
ccttttggtctggttacaaaagaagggaagaagctctctactcgtaaagggaatgtcatc
ttgctagagcctactgttgcagaggctgttagccgtgccaaggtccaaatcgaggctaaa
aatcctgaactagaaaacaaagaccaagtagcacatgctgttggggttggagccattaaa
ttctatgacctcaaaactgaccgtacaaatggatacgacttcgacctagaagctatggta
tccttcgagggtgaaactggaccttacgttcaatatgcctacgctcgtatccaatctatc
ttacgcaaagccgatttcaaaccagaaatagctggcaactatagcttgaatgatactgaa
agctgggaaatcattaaactcattcaagacttcccacgtattatcaaccgtgcggcagat
aactttgaaccttctatcattgctaaatttgcaattagcctggctcaatcctttaacaaa
tactatgcacatacacgtatcttggatgaaagcccagaacgcgacagccgtctagccctc
agctacgcaaccgcagtcgttctcaaagaagcccttcgcttgcttggagtagaagcgcca
gagaagatgtaa

DBGET integrated database retrieval system