KEGG   Streptomyces noursei: SNOUR_22125Help
Entry
SNOUR_22125       CDS       T04806                                 

Definition
(GenBank) tryptophan 23-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
snr  Streptomyces noursei
Pathway
snr00380  Tryptophan metabolism
snr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    SNOUR_22125
Enzymes [BR:snr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     SNOUR_22125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: ANZ17708
UniProt: A0A1B2GUU8
Position
5008668..5009552
Genome map
AA seq 294 aa AA seqDB search
MSQPSPTHPAHRAPDTAAAEADPPFGPDLSIGAGNATPYEDYVQASVLTHLQHLQSDDPG
EMVFLVTTQVMELWFTVIVHEWTTAADALRRDDLPVAMDALRRSTWELEALNAAWKPLAR
LTPAQFNAYRAALGEGSGFQSAMYRRLEFLLGEKSASMLVPHRGSPQDHAALEKALHEPS
LYDEVLRLLARRGHPIPETVLRRDPTRRYESDPAVEEVWAAVLAGAQDSELARLGELLTD
VAELVWRWRNDHLVATRRAMGAKMGTGGSAGVAWLEKRARKNVFPELWTARSHV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagccgtctcccacccaccccgcgcaccgcgccccggataccgcggccgccgag
gcggacccgccgttcggccccgacctgagcatcggcgccggcaatgccaccccgtacgag
gactacgtccaggcgagcgttctcacccacctccagcacctccagtccgacgacccgggc
gagatggtcttcctggtcaccacccaggtgatggagctgtggttcaccgtcatcgtccac
gagtggacgaccgccgccgacgcgctgcgccgggacgacctgccggtggcgatggacgcg
ctgcgccgttccacgtgggagctggaggcgctgaacgccgcctggaagccgctcgcccgg
ctgacgcccgcgcagttcaacgcctaccgcgccgcgctcggcgagggcagcggcttccag
tccgcgatgtaccggcggctggagttcctgctcggcgagaagtccgcgtcgatgctggtg
ccgcaccgcggttccccgcaggaccacgccgcgctggagaaggcgctgcacgaaccgagc
ctgtacgacgaggtgctgaggctgctggcccgccgcggccacccgatcccggagacggtg
ctgcggcgcgacccgacccggcgctacgagtcggacccggcggtcgaggaggtctgggcc
gccgtcctcgccggcgcgcaggattccgaactcgcccggctcggcgagctgttgaccgat
gtcgcggagctggtctggcgctggcgcaacgaccatctggtcgcgacccggcgggcgatg
ggagcgaaaatgggtaccggcggatccgcgggagtcgcctggctggagaagcgggcccgc
aagaacgtctttcccgagctgtggacggcgcgaagccatgtctga

DBGET integrated database retrieval system