KEGG   Streptomyces noursei: SNOUR_22405Help
Entry
SNOUR_22405       CDS       T04806                                 

Gene name
lhgO
Definition
(GenBank) L-2-hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
snr  Streptomyces noursei
Pathway
snr00310  Lysine degradation
snr01100  Metabolic pathways
snr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:snr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    SNOUR_22405 (lhgO)
Enzymes [BR:snr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     SNOUR_22405 (lhgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Pyr_redox_2 FAD_binding_3 Amino_oxidase Mqo Thi4 Lycopene_cycl FAD_binding_2 Trp_halogenase Pyr_redox_3 NAD_binding_9 TrkA_N Pyr_redox HI0933_like AlaDh_PNT_C 3HCDH_N ApbA NAD_binding_7 Sacchrp_dh_NADP K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ANZ17757
UniProt: A0A1B2GUY3
Position
complement(5072566..5073813)
Genome map
AA seq 415 aa AA seqDB search
MAAYDCDVLVIGAGIVGLSTAHALTRAAPGIRVVVLEKEPAAARHQTGRNSGVIHSGIYY
PPGSLKARFALQGAAEMVEFCTAHDIPHEVTGKLIVATDRAELPRLHGLIQRGREHGLPV
RELGPAQIAEYEPEVRGLAAIHVGTTGICDFGAVARQLARLAQEDGARVVLGEEVTTIAR
RPGRVAVRTAGGTVYRARALVNCAGLHCDRVARLAGDAPGMRIVPFRGEYYTLAPERAAL
VRGLVYPVPDPAFPFLGVHLTRGIDGSVHIGPNAVPALAREGYDWRTVRPTELAGTLGYP
GSWRIARRHWRYGAGELHRSLSRRAFTDAVRRLLPAAREEDLLPSPAGVRAQAVLPDGTL
VDDFLFAESPGMIHVLNAPSPAATASLPIGREVARRVTRLLGLPECAAQDGGLAG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcgtacgactgcgacgtgctggtgatcggtgccgggatcgtggggctttccacg
gcccatgccctcacgcgcgcggcacccggtatacgcgtcgtggtgctggagaaggagccc
gccgcggcccgccaccagaccgggcggaacagcggcgtgatccacagcggcatctactac
ccaccgggttcgctgaaggcccgcttcgccctccagggggcggcggagatggtcgagttc
tgcaccgcgcacgacatcccgcacgaggtcaccggcaagctgatcgtcgccaccgaccgc
gccgagctgccccggctgcacggcctcatccagcgcggccgcgagcacggcctgccggtg
cgggagctgggcccggcccagatcgccgagtacgagcccgaggtgcgcggcctggccgcg
atccacgtgggcacgaccggcatctgcgacttcggggcggtggcccggcagctggcccgc
ctcgcgcaggaggacggggcccgggtcgtcctcggcgaggaggtcaccaccatcgcccgc
cgccccggccgggtcgcggtccgcaccgccggcggcacggtctaccgcgcccgcgccctg
gtcaactgcgccgggctgcactgcgaccgggtggcgcggctggcgggcgacgccccgggc
atgcggatcgtgccgttccggggcgagtactacaccctcgcaccggagcgcgccgccctg
gtccgcgggctggtgtacccggtccccgaccccgccttcccgttcctgggcgtccatctc
acccgcggcatcgacggctccgtccacatcgggccgaacgccgtccccgcgctggcccgc
gagggctacgactggcgcaccgtccgtcccaccgagctcgccggcacgctcggctacccc
ggttcctggcggatagcccgccgccactggcgctacggcgcgggcgagctccaccgctcg
ctgtcccgccgtgccttcacggacgcggtccgccgcctgctgccggccgcccgggaggag
gatctgctgccgtcgccggccggggtccgggcccaggccgtgctgcccgacggcaccctc
gtcgacgacttcctgttcgccgagtcccccggcatgatccacgtcctcaacgccccgtcc
ccggccgccacggcctccctcccgatcgggcgggaggtggcccggcgggtgacccggctg
ctggggctcccggagtgcgcggcgcaggacgggggcctcgcggggtga

DBGET integrated database retrieval system