KEGG   Streptomyces noursei: SNOUR_30005Help
Entry
SNOUR_30005       CDS       T04806                                 

Definition
(GenBank) putative RNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
snr  Streptomyces noursei
Brite
KEGG Orthology (KO) [BR:snr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:snr03009]
    SNOUR_30005
Enzymes [BR:snr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     SNOUR_30005
Ribosome biogenesis [BR:snr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SNOUR_30005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: ANZ19246
UniProt: A0A1B2GZC0
Position
6784184..6785125
Genome map
AA seq 313 aa AA seqDB search
MSSFPEIRTLPVPDGLEGERVDAALARMFGFSRTKAAELASAGKVRVDGAEVMKSERVRG
GAWLEVEMPAAAAPVEIVAEPVEGMEIVHDDDDIVVIVKPVGVAAHPSPGWSGTTVIGGL
AAAGYRISTSGAAERQGIVHRLDVGTSGLMVVAKSERAYTSLKRQFKERVPDKRYHALVQ
GHPDPMSGTIDAPIGRHPNHDYKWAVIADGKPSVTHYDLIEAFRAASLLDIKLETGRTHQ
IRVHMSAHRHPCVGDMTYGADPTLAKRLGVARQWLHAVRLGFEHPSDGRWVEFESAYPAD
LQRALDTVREESY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcttccccgagatccgcaccctgcccgtaccggacggcctggagggcgagcgc
gtggacgccgcgctggcccgcatgttcggcttttcccggacgaaggcggccgagctcgcg
tcggccggcaaggtccgggtcgacggcgccgaggtgatgaagtccgagcgggtgcgcggg
ggcgcctggctggaggtcgagatgccggccgccgccgcgccggtcgagatcgtggccgag
cccgtcgagggcatggagatcgtgcacgacgacgacgacatcgtggtgatcgtcaagccg
gtgggggtcgccgcgcaccccagccccggctggagcggcacgaccgtcatcggtggtctg
gccgcggccggctaccggatctccacctcgggggcggccgagcggcagggcatcgtgcac
cgtctcgacgtcgggacctccgggctgatggtggtcgccaagtcggagcgcgcgtacacg
tcgctgaagcggcagttcaaggagcgggtgccggacaagcgctaccacgcgctggtgcag
ggccacccggacccgatgagcggcaccatcgacgcccccatcgggcggcaccccaaccac
gactacaagtgggcggtcatcgccgacggcaagccgtcggtcacccactacgacctgatc
gaggcgttccgggcggccagcctgctggacatcaagctggagaccggccggacgcaccag
atccgggtgcacatgtccgcgcaccggcacccctgcgtcggcgacatgacctacggcgcg
gaccccaccctggccaagcggctgggcgtggcccggcagtggctgcacgcggtgcggctg
ggctttgagcacccctcggacgggcgctgggtcgagttcgagagcgcgtacccggcggac
ctccagcgtgcgctggacaccgtccgggaagagagctactga

DBGET integrated database retrieval system