KEGG   Streptomyces noursei: SNOUR_37535Help
Entry
SNOUR_37535       CDS       T04806                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
snr  Streptomyces noursei
Pathway
snr00260  Glycine, serine and threonine metabolism
snr01100  Metabolic pathways
snr01110  Biosynthesis of secondary metabolites
snr01120  Microbial metabolism in diverse environments
snr01130  Biosynthesis of antibiotics
snr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:snr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SNOUR_37535
Enzymes [BR:snr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SNOUR_37535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP PaaX
Motif
Other DBs
NCBI-ProteinID: ANZ20735
UniProt: A0A1B2H3F8
Position
complement(8489763..8490824)
Genome map
AA seq 353 aa AA seqDB search
MPAPIDLRSDTLSTITPQMRRYMADAEVGDDLYGGDPTTQRLERRCAELLGKEAALFTAS
GTLSNQLAIRVHTDRGSEIVTDAKYHINFFESAATADLSGVVLNPVDSPDGILTPRLLDA
AVDRKRRARLTSAPSLVWVENTVNYYGGRAISVSDLADLRAASLAKGLPTHMDGARLPNA
SVATGASLAEYAATVDTVAVSFAKALGAPFGSVLAGPAELIERAGVYRLWYGGGLHQSGF
MAAAALYALEHNIDRLAEDHAHARLLRELLVESPAFTAPEPETNMVIADVSGTGLSSAEF
VSAAAEAGVKVARWTDTQVRIVARLGVDEAVVRDAVRRLHRVADRQPSPAMKP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcaccaatcgacctgcgcagcgacaccttaagcaccatcactccgcagatgcgc
cgctacatggcggacgccgaggtgggcgacgacctctacggcggagaccccaccacccag
cgcctggagcgccgttgcgccgaactcctcggaaaagaggcagcgctcttcaccgcgagc
ggcaccctgagcaaccagctggcgatccgcgtgcacacggaccgcggcagcgaaatcgtc
accgacgcgaagtaccacatcaacttcttcgagagtgcggccaccgccgatctgtccggc
gtcgtgctcaaccccgtggacagcccggacggcatcctcacgccccgcctcctggacgcc
gccgttgaccgcaagcggcgtgcccggctcacctccgccccgtccctggtatgggtcgag
aacaccgtcaactactacggcggcagggcgatttcggtgtccgacctggccgacctgcgc
gcggcctcgctcgccaagggcctgccgacgcacatggatggcgcccggctgcccaacgcg
agcgtcgccaccggcgcctcgctcgccgagtacgccgccaccgtggacaccgtcgcggtc
tccttcgccaaggccctcggcgcgcccttcggcagtgtcctcgccggcccggccgaactg
atcgagcgggccggcgtctaccgcctgtggtacggcggcggcctgcaccagtccggcttc
atggcggccgccgcgctgtacgccctggaacacaacatcgaccggctcgccgaggatcac
gcccacgcccggttgctgcgcgaactcctcgtcgagagcccggcgttcaccgcccctgaa
cccgagaccaacatggtcatcgcggatgtctccggcaccggcctcagctcggcggagttc
gtctcggccgccgccgaagccggtgtgaaggtcgcccgctggaccgacacacaggtccgg
atcgtcgcgcgactcggcgtggacgaggccgtcgtacgcgacgccgtgcggcgcctgcac
cgggtggccgaccggcagccctccccggccatgaagccatga

DBGET integrated database retrieval system