KEGG   Sneathia amnii: VC03_01125Help
Entry
VC03_01125        CDS       T03854                                 

Definition
(GenBank) hypothetical protein
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
sns  Sneathia amnii
Pathway
sns00072  Synthesis and degradation of ketone bodies
sns00280  Valine, leucine and isoleucine degradation
sns00650  Butanoate metabolism
sns00900  Terpenoid backbone biosynthesis
sns01100  Metabolic pathways
sns01110  Biosynthesis of secondary metabolites
sns01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sns00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VC03_01125
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    VC03_01125
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VC03_01125
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VC03_01125
Enzymes [BR:sns01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     VC03_01125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III Chal_sti_synt_N ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKC96114
UniProt: A0A0E3UUD1
Position
223255..224385
Genome map
AA seq 376 aa AA seqDB search
MKIGIDKMGIYIPRYYLDIRDLAKERNIDPDKFVIGLGQSKMSVNPISQDIVTFGVLAAD
KILTDEDKKKIDMLIVGTETGVDQSKSASAFMHSILGINEYCRSIEIKQACYGATAALQV
AKNHILVNPDSKVLVIASDIAKYGINTSGESTQGCGAVAMLVSRDPKMLEISNESVCYTK
DVMDFFRPNNSTYAIANGKLSTNTYLESLEKVYYEFSNRFGEKDFSAICFHIPYPKLGLK
GLKEIKREDLLEEFNNSIMYNKEIGNIYTGSLFLSLISLLENSKKIKANDLIGLYSYGSG
AVSEFFTMKVVEGYEKHLSIKENQKMLENRVKLSVSEYEEMFFSKIEHEKEIENKEGEDV
YLKGIFNNERTYARKI
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggtattgataagatgggtatatatatacctagatattatttggatataagg
gacttggctaaagaacgtaatatagatccagataagtttgtaataggtcttggtcaaagc
aagatgtctgttaatcccattagtcaggatatagtgacatttggagttttagcagcagat
aagatattaacagatgaagataagaaaaaaatagatatgttaatagttggaacggaaaca
ggagtagaccaatcaaaatctgctagtgcatttatgcattctatacttggtataaacgaa
tattgtagaagtatagaaataaagcaagcatgttatggtgcaacagctgccctacaagta
gcaaaaaatcatatactagtaaatccagatagtaaagttttggtaatagcaagtgatatt
gcaaaatatggaataaatactagtggtgaatcaacacaaggatgtggagctgtagctatg
cttgtatcgagagatccaaagatgctagaaatatctaatgagtctgtatgctatacaaaa
gatgttatggacttttttagaccaaataattctacttatgccatagctaatggtaaatta
tctactaatacttaccttgaatctttagaaaaagtatattatgaattttctaatagattt
ggtgaaaaggattttagtgcaatttgtttccatataccatatcctaaattaggattaaag
ggattaaaagagataaaaagagaagacttgttggaagaatttaataattcaataatgtat
aacaaagaaatagggaatatttatacaggttcactattcttaagtctaatttcattatta
gaaaacagtaaaaaaattaaagctaacgacttaataggtctatatagctacggttcagga
gcagtcagtgaatttttcactatgaaggtagttgaaggatacgaaaaacacttaagtata
aaagaaaatcaaaagatgttggaaaatagggttaaacttagtgttagtgaatatgaagaa
atgtttttttctaaaatagagcatgaaaaagaaatagaaaataaagaaggagaagatgta
tacctaaagggtatatttaacaatgaaagaacatatgctagaaaaatttaa

DBGET integrated database retrieval system